Navigation Links
New anticoagulant discovered based on the same used by malaria vectors to feed on
Date:12/11/2012

An international project lead by the Molecular and Cell Biology Institute of Porto University with the participation of researchers from IMIM (Hospital del Mar Medical Research Institute) has, for the first time ever, deciphered the mechanism by which a substance called anophelin binds to an enzyme (thrombin) involved in the process of blood coagulation. This discovery was published in the last issue of the PNAS journal and opens the door to, on the one hand, designing a new generation of anticoagulant drugs with a totally different functioning to current ones and, on the other hand, fighting against the spreading of malaria by designing inhibitors for this substance.

Anophelin is a substance playing a crucial role in the nutrition of a large number of parasites like malaria-carrying Anopheles mosquitoes or vampire bats. These animals need to feed on fresh blood and stop it from coagulating while they are eating. To make this possible, they use powerful inhibitors of the coagulation process mainly affecting thrombin. Researchers have discovered that "anophelin blocks thrombin in a new and different way than other substances: it's like a key fitting in a lock of a door, but in this case the key fits in the other side" explains Ricardo Gutirrez Gallego, a member of the IMIM Bioanalysis research group.

The project is based on two recent studies which led to the discovery of thrombin inhibitors presenting new structures. For the inhibitor produced by Anopheles mosquitoes (anophelin), it was seen that after binding to thrombin, proteins did not degrade, so a systematic study was launched for all coagulants in the several variants of the Anopheles mosquito. By using very powerful and sensitive analytical techniques it was possible to determine and monitor in real time the molecule interactions in both anophelin and thrombin, leading to a detailed characterization of their structure and interaction. Researchers also performed mutations on thi
'/>"/>

Contact: Marta Calsina
mcalsina@imim.es
34-933-160-680
IMIM (Hospital del Mar Medical Research Institute)
Source:Eurekalert

Page: 1 2

Related biology news :

1. Global Market for Blood Banking and Blood Products Projected to reach $43 billion by 2018; Spectrometers and Fluorometers to Reach $18.4 bn; Anticoagulants to Reach $12.9 bn; Cell and Tissue Culture Supplies to Reach $5.6 bn
2. Hearty organisms discovered in bitter-cold Antarctic brine
3. Microbial missing link discovered after man impales hand on tree branch
4. Newly discovered effects of vitamin D on cancer
5. Missing link discovered in the defence mechanism of the tuberculosis pathogen
6. New cause of thyroid hormone deficiency discovered
7. Undersea gas leaks off Israels coast are discovered by University of Haifa researchers
8. Sweet new approach discovered to help produce metal casting parts, reduce toxicity
9. 9 colorful and endangered tree-dwelling tarantulas discovered in Brazil
10. New genes discovered for adult BMI levels
11. Living power cables discovered
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/24/2014)... its launch in December 2014, the 1U™ app ... trying to remember their usernames and passwords through replacing the ... To assist people who have struggled to remember usernames and ... and focuses on redefining identity, announced today that it is ...
(Date:12/22/2014)... DUBLIN , Dec. 22, 2014 Research and ... the addition of the "The Global Watermarking ... http://photos.prnewswire.com/prnh/20130307/600769 ... global digital media watermarking and fingerprinting markets. Watermarking ...
(Date:12/19/2014)... , Dec. 18, 2014 Research and Markets ... "iPhone 5S Fingerprint Sensor - Apple/AuthenTec TMDR92 & ... http://photos.prnewswire.com/prnh/20130307/600769 ... introduced the fingerprint reading feature with the iPhone 5S. ...
Breaking Biology News(10 mins):1U Offers Best Solution to the Username / Password Dilemma: For FREE! 21U Offers Best Solution to the Username / Password Dilemma: For FREE! 3The Global Watermarking and Fingerprinting Markets 2iPhone 5S Fingerprint Sensor - Apple/AuthenTec TMDR92 & Sapphire - Technology Report 2
... in a group of heat-loving bacteria by researchers at ... light a fire under next-generation biofuel production. Scientists ... to break down complex plant material such as switchgrass ... make biofuels. Conventional processes involve the addition of commercially ...
... faded since the end of the Cold War, existing ... devastating global impacts. Researchers at the University of ... effects of a hypothetical nuclear war between India and ... in distant countries. The work, by Mutlu Ozdogan ...
... in our bodies. This process is driven by microtubule filaments ... so-called motor proteins in the cytosol can control their dynamics. ... of cell division. It is composed in large part of ... size, shape and mobility of a cell. In a new ...
Cached Biology News:BESC researchers tap into genetic reservoir of heat-loving bacteria 2War-related climate change would reduce substantially reduce crop yields 2
(Date:1/22/2015)... 2015 Protocol Networks brings independent technology ... of brand-neutral, independent consultants, Protocol Networks has recently announced ... over the years, his company has attracted several clients ... Plainfield, as well as others. With the success of ...
(Date:1/22/2015)... Pipette.com has added the Eppendorf ... portfolio of Eppendorf products. , The Eppendorf Centrifuge 5424/5424 ... 5424/5424 R and receive the following:, , ... or Eppendorf Reference 2 ,     3 Free ...
(Date:1/22/2015)... Madison, WI (PRWEB) January 22, 2015 Dr. ... at the 12th annual Scripps Natural Supplements Pre-Conference seminar on ... Supplements Conference is an annual continuing education conference for health ... 15th and included the topic of probiotics in health. Dr. ...
(Date:1/22/2015)... January 22, 2015 Selexis SA, a ... Research Cell Banks (RCBs) used for drug discovery to ... Banks will include Next-Generation Sequencing (NGS) data ... de-risks biologic manufacturing by ensuring the integrity of the ...
Breaking Biology Technology:Protocol Networks Brings Independent Technology Consulting to the Constitution State 2Eppendorf Announces Promotional Bundle Which Includes: Eppendorf Centrifuge 5424, 3-Pack of Pipettes, and Tips - Available Now at Pipette.com 2Selexis Generated Research Cell Banks Now Fully Sequenced Using Next-Generation Sequencing 2
... AUSTIN, Texas and TORONTO, Oct. 3 Two ... to integrate vibration,therapy into the stem cell harvesting ... company based in Austin,Texas, has signed an exclusive ... of Toronto, Ontario. The partnership,between the two companies ...
... ),AMDL, Inc. (Amex: ADL ), a leading vertically ... US, today announced that the,Company will present at the ... Tuesday, October 7, 2008 at 10:30 a.m. ET. AMDL,s ... Hotel in the Morosco Room., The Maxim Group ...
... Stock Exchange Symbol: MS, EDMONTON, Oct. 3 ... developer in the treatment of multiple sclerosis (MS), ... (DSMB) for the,Company,s U.S. pivotal phase III MAESTRO-03 ... MS has completed a safety analysis,and recommended that ...
Cached Biology Technology:New Partnership Integrates Vibration Therapy Into Stem Cell Procedures 2New Partnership Integrates Vibration Therapy Into Stem Cell Procedures 3AMDL, Inc. to Present at Maxim Group Growth Conference October 7, 2008 2AMDL, Inc. to Present at Maxim Group Growth Conference October 7, 2008 3BioMS Medical's phase III U.S. multiple sclerosis trial receives positive safety review from Data Safety Monitoring Board 2
... for high-yield protein expression ,The ... a high-yielding clone of Sf9 cells. Pre-adapted ... Cell Medium, these cells are recommended for ... baculovirus infection or transfection of appropriate vectors. ...
... Mouse monoclonal antibody raised against a partial recombinant ... 358 a.a. ~ 457 a.a) partial recombinant protein ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Mouse monoclonal antibody raised against a partial recombinant QARS. NCBI Entrez Gene ID = QARS...
Biology Products: