Navigation Links
Networks of small habitat patches can preserve urban biodiversity
Date:11/13/2008

limited budget. Our study empirically shows that the network modeling approach is a good candidate for developing such a tool" said Dr. Bodin.

The study combines empirical field studies of birds with theoretical and statistical modelling. A range of bird species were surveyed in various green areas of different size and type in the urban area of Stockholm, Sweden. Geographical Information System (GIS) techniques were deployed to model the urban landscape as a network of individual habitat fragments. The field data were then used to test and verify the assumptions behind the network model.

Modelling a landscape as a network provides for many new analytical possibilities. However, the network modelling approach as such has, until now, rarely been tested empirically.

"Our study gives strength to the network perspective of landscapes, and thus supports further development of new and exiting network-based analyses that could help managers to preserve valuable ecological functions even in very fragmented landscapes" said Dr. Andersson.

The study also showed that it is important to differentiate between different types of green areas when constructing a habitat network since many species have quite different habitat preferences. In addition, the effect of movement barriers and the existence of stepping stones should be included in the analysis, a fact which is particularly relevant in urban areas.


'/>"/>

Contact: Ellika Hermansson Trk
ellika@stockholmresilience.su.se
468-674-7744
Wiley-Blackwell
Source:Eurekalert

Page: 1 2

Related biology news :

1. IdentiPHI Re Launches SAFmodule Software to Secure Novell(R) Networks
2. IdentiPHI Re Launches SAFmodule Software to Secure Novell(R) Networks
3. Alternative food networks connect ethical producers and consumers and can lead to healthier eating
4. Solidus Networks, Inc. Seats New Board of Directors
5. Gene Networks in Animal Development and Evolution Feb. 15 and 16
6. Nature paper describes technique for extracting hierarchical structure of networks
7. Rainfall and river networks prove accurate predictors of fish biodiversity
8. Using networks to map the social lives of animals
9. New evidence on the robustness of metabolic networks
10. CSHL team traces extensive networks regulating alternative RNA splicing
11. GEN reports on novel tools for deciphering biological networks
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:1/22/2015)... OXFORD, Conn. , Jan. 20, 2015 NXT-ID, Inc. (NASDAQ: ... growing mobile commerce market, reports on the recent success of the Wocket™ ... Wocket smart wallet was named as one of the ... of the "5 Best Products Launched At CES So Far" by Newseveryday.com ...
(Date:1/22/2015)... MUNICH , January 22, 2015 ... its tenth year  The European Patent Office to present ... Two British nominations to be featured: Christofer Toumazou ... week featuring former finalists and winners of the Award   ...
(Date:1/22/2015)... 2015 Infinisource has launched its new NXG series of ... G2 sets a higher standard for collecting attendance and labor ... With plug-and-play installation, touch screen interface and seamless connection to ... time collection solution for the small to mid-size employer. ...
Breaking Biology News(10 mins):CES Response for NXT-ID's Wocket Smart Wallet Kicks Off 2015 2CES Response for NXT-ID's Wocket Smart Wallet Kicks Off 2015 3Ten Years of the European Inventor Award: A Retrospective Look at the Inventors and Ideas That Have Changed Our Lives 2Ten Years of the European Inventor Award: A Retrospective Look at the Inventors and Ideas That Have Changed Our Lives 3Infinisource's NXG series sets new time clock standard 2
... a female insect in order to attract males for pollination. ... Biology found that breeding two of these orchid species ... This new odour had no effect on normal solitary bees ... of wild bee that never visited any of the parent ...
... , Nerve cells communicate with each other by means ... cells exchange charged ions with their environment. However, the ... although some theories predicted a relation between the chloride ... Institute of Neurobiology in Martinsried were now able to ...
... A Georgetown University Medical Center research team has been ... Abuse to discover and develop new smoking cessation drugs ... Kenneth Kellar, PhD, a professor of pharmacology at GUMC ... $4.6 million. The theory, developed in Kellar,s lab ...
Cached Biology News:Chloride channels render nerve cells more excitable 2Chloride channels render nerve cells more excitable 3GUMC to develop smoking cessation aids based on unconventional nicotine addiction theory 2
(Date:1/22/2015)... , Jan. 22, 2015  Transwestern | RBJ today announces the ... office space for Shire a leading biopharmaceutical company, at Two ... | RBJ,s Robert Richards , president, and Brian ... for the entire five-floor building at 95 Hayden Ave. ...
(Date:1/22/2015)... January 21, 2015 Cambridge Semantics, the leading ... today announced that 2014 was a record-breaking year across the ... of the Anzo Smart Data Platform and our Smart Data ... insights from diverse data which led to record growth for ...
(Date:1/22/2015)... January 22, 2015 Crystal Diagnostics (CDx) Xpress ... it has received AOAC-PTM Certifications for the six non-O157 Shiga ... O145; collectively referred to as STEC or the “Big-6”) as ... forming unit (cfu) per 325 g of raw ground beef ...
(Date:1/22/2015)... Dr. Greg Leyer of UAS Labs recently was ... Pre-Conference seminar on probiotics in San Diego, CA. , ... conference for health care professionals. This year’s pre-conference seminar was ... in health. Dr. Leyer spoke about the emerging topics and ...
Breaking Biology Technology:Transwestern | RBJ Advises Shire in 202,000 SF Lease, Creating Boston's Largest Suburban Biotech Campus 2Cambridge Semantics Announces Record Results for 2014 2Crystal Diagnostics Awarded AOAC-PTM Accreditation for the Rapid Detection of “Big 6” E.coli Food Pathogens 2
... Vaccine Induced Neutralizing Antibodies and Protected Mice upon ChallengeROCKVILLE, ... NVAX ) announced results from a preclinical study of ... the viral fusion (F) protein. The virus utilizes ... respiratory tract and cause illness. Novavax,s RSV-F ...
... Boston Scientific Corporation (NYSE: BSX ) ... ended December 31, 2008. Subsequent to the release ... a patent litigation settlement and, as expected, finalized a ... U.S. Generally Accepted Accounting Principles, these events are required ...
... 26 InterMune, Inc.,(Nasdaq: ITMN ) today announced ... December 31, 2008. InterMune reported a net loss for ... share, compared with a,net loss of $25.9 million, or $0.67 ... Dan Welch, Chairman, Chief Executive Officer and ...
Cached Biology Technology:NOVAVAX Announces Preclinical Study Results for a Respiratory Syncytial Virus ('RSV') Vaccine Candidate Directed Against the Fusion (F) Protein 2NOVAVAX Announces Preclinical Study Results for a Respiratory Syncytial Virus ('RSV') Vaccine Candidate Directed Against the Fusion (F) Protein 3NOVAVAX Announces Preclinical Study Results for a Respiratory Syncytial Virus ('RSV') Vaccine Candidate Directed Against the Fusion (F) Protein 4Boston Scientific Resolves Outstanding Litigation Matter, Finalizes Goodwill Impairment Charge 2Boston Scientific Resolves Outstanding Litigation Matter, Finalizes Goodwill Impairment Charge 3Boston Scientific Resolves Outstanding Litigation Matter, Finalizes Goodwill Impairment Charge 4Boston Scientific Resolves Outstanding Litigation Matter, Finalizes Goodwill Impairment Charge 5Boston Scientific Resolves Outstanding Litigation Matter, Finalizes Goodwill Impairment Charge 6Boston Scientific Resolves Outstanding Litigation Matter, Finalizes Goodwill Impairment Charge 7Boston Scientific Resolves Outstanding Litigation Matter, Finalizes Goodwill Impairment Charge 8Boston Scientific Resolves Outstanding Litigation Matter, Finalizes Goodwill Impairment Charge 9Boston Scientific Resolves Outstanding Litigation Matter, Finalizes Goodwill Impairment Charge 10InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 2InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 3InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 4InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 5InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 6InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 7InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 8InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 9InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 10InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 11InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 12
... for high-yield protein expression ,The ... a high-yielding clone of Sf9 cells. Pre-adapted ... Cell Medium, these cells are recommended for ... baculovirus infection or transfection of appropriate vectors. ...
... Mouse monoclonal antibody raised against a partial recombinant ... 358 a.a. ~ 457 a.a) partial recombinant protein ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Mouse monoclonal antibody raised against a partial recombinant QARS. NCBI Entrez Gene ID = QARS...
Biology Products: