Navigation Links
Monell scientists help identify a missing link in taste perception
Date:3/6/2013

Feinstein Institute for Medical Research, the knockout mice lack the gene that codes for CALHM1.

"Like humans, mice with an intact CALHM1 gene avidly drink sucrose and other sweeteners, and avoid bitter compounds such as quinine. However, mice lacking CALHM1 are very unusual," said Tordoff. "These mice treat sweeteners and bitter compounds as if they were water. They behave as if they can't taste them at all."

Responses to salty and sour tastes were not affected by the missing gene because perception of these taste qualities is mediated via a different set of taste cells.

In combination with electrophysiological data contributed by collaborators from other institutions, the findings demonstrate that pannexins and connexins, channel proteins previously thought to be involved in ATP release from taste cells, actually are not necessary for this to happen. "This paper provides compelling data to overturn the previous hypothesis," noted Matsumato. "It's part of what makes science so exciting."

Kevin Foskett, PhD, professor of Physiology at the Perelman School of Medicine, University of Pennsylvania, who with Marambaud is a senior author on the paper, recently identified CALHM1 as an ATP channel and speculated that that it might be involved in taste. "This is an example of a bona fide ATP ion channel with a clear physiological function," said Foskett. "Now we can connect the molecular dots of sweet and other tastes to the brain."

In addition to revealing CALHM1's critical role in sweet, bitter, and umami taste perception, the current work also lends insight into the channel's overall function in other tissues. Originally thought to control calcium levels inside cells, CALHM1 (calcium-homeostasis-modulator-1) may also contribute to ATP-mediated intercellular communication in the brain and elsewhere.


'/>"/>

Contact: Leslie Stein
stein@monell.org
267-519-4707
Monell Chemical Senses Center
Source:Eurekalert

Page: 1 2

Related biology news :

1. Mechanisms involved in resistance to the bacteria Salmonella studied in a Ph.D. thesis
2. Assessing a new technique for ensuring fresh produce remains Salmonella-free
3. Salmonella infection, but not as we know it
4. UCSB researchers discover particularly dangerous Salmonella
5. UCSB researchers find a way to detect stealthy, hypervirulent Salmonella strains
6. UCI-led study uncovers how Salmonella avoids the bodys immune response
7. UF scientists discover new crocodilian, hippo-like species from Panama
8. UT Southwestern scientists make mouse model of human cancer, demonstrate cure
9. Sea lamprey genome mapped with help from scientists at OU
10. Sequestration will be a devastating blow to the nations research institutions and scientists
11. Scientists explore topical health issues at meeting in Texas
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/25/2015)... June 25, 2015 According ... Type (Swipe & Area), Technology, Material (Optical Prism, ... Commercial Security & Others) & Geography - Global ... the said market is expected to reach $14,500.07 ... Browse 76 market Tables and ...
(Date:6/25/2015)... , June 25, 2015  TAKE Solutions Ltd., ... patent by the United States Patent and Trademark Office ... This process leverages TAKE Solutions, Clinical Accelerators to reduce ... 50% (when compared to standardization without the accelerators), thus ... At the heart of the ...
(Date:6/24/2015)... NEW YORK , June 24, 2015 ... Systems market, over the next six years. It contains ... affect the industry, along with their impact from the ... It also discusses the industry, market, and technology ... expected that the need of concerned authorities to efficiently ...
Breaking Biology News(10 mins):Fingerprint Sensors Market Worth $14,500.07 Million by 2020 2Fingerprint Sensors Market Worth $14,500.07 Million by 2020 3Fingerprint Sensors Market Worth $14,500.07 Million by 2020 4TAKE Solutions Awarded Patent By USPTO 2Automatic Identification System Market by Class, by Platform, by Application and by Geography - Global Forecasts & Analysis to 2014 - 2020 2
... ?one from Louisiana, one from Japan and one ... to involvement of endocannabinoids as a novel neural ... in eating, disease treatment and social behavior. , ... team from Tulane and Louisiana State Universities, led ...
... as fertility drugs may be ineffective for women who ... study showed that fertility drugs did not improve ovulation ... estrogen receptor beta. The estrogen receptor beta is one ... of estrogen hormones and are present throughout the female ...
... extension in yeast have been identified by researchers from UC ... or caloric restriction, is known to extend the lifespan of ... gene called Sir2 with lifespan extension due to caloric restriction, ... when put on a tough diet, showing that some other ...
Cached Biology News:Endocannabinoids ?the brain's cannabis ?demonstrate novel modes of action to stress 2New Discovery May Help Doctors Treat Infertility 2New Discovery May Help Doctors Treat Infertility 3
(Date:7/2/2015)... 2, 2015  Spherix Incorporated (Nasdaq: SPEX ) -- an ... monetization of intellectual property, today announced a litigation update. ... v. Verizon Services Corp. et al. , Case No. ... Eastern District of Virginia , the ... interpreting certain key claims in favor of the Defendants ...
(Date:7/1/2015)... ... July 01, 2015 , ... It is now possible ... using single photon emission computed tomography (SPECT) according to researchers from Amen ... examined over 20,000 brain scans and is believed to be the largest brain imaging ...
(Date:7/1/2015)... AURORA, Colo. and BANGALORE, India ... a global genomic profiling company that uses next generation ... appointment of Scott A. Storrer as chief ... and CEO, he will be responsible for all strategy, ... Vijay Chandru , who has served as Strand,s chairman ...
(Date:7/1/2015)... ... July 01, 2015 , ... A newly launched business plan contest ... the barriers to innovation in life sciences R&D. The Pistoia Alliance President’s Startup Challenge ... of US$15,000 and a period of expert mentorship from a senior industry figure drawn ...
Breaking Biology Technology:Spherix Issues A Litigation Update 2Spherix Issues A Litigation Update 3Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 2Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 3Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 4Strand Life Sciences Names Scott A. Storrer CEO as Company Continues Global Expansion with Focus on Precision Medicine Product 2Strand Life Sciences Names Scott A. Storrer CEO as Company Continues Global Expansion with Focus on Precision Medicine Product 3Pistoia Alliance Launches Startup Challenge 2Pistoia Alliance Launches Startup Challenge 3
... Calif.,  Oct. 27 SRI International, an independent nonprofit ... Geysen, Ph.D., has joined SRI International,s Center for Advanced ... new role, Dr. Geysen will expand SRI,s research capabilities ... establish programs to develop novel molecules that control hormonal ...
... PDL BioPharma, Inc. (PDL, the Company) ... entered into separate privately negotiated exchange agreements under which it ... outstanding 2.00% Convertible Senior Notes due February 15, 2012 (the ... the 2012 Notes will receive $92.0 million in aggregate principal ...
... 27 Ardea Biosciences, Inc. (Nasdaq: RDEA ) ... executive officer, will present at the Oppenheimer 21st Annual Healthcare ... present at 10:50 a.m. EDT on Tuesday, November 2, 2010. ... be accessed on the Investor Relations section of Ardea,s website ...
Cached Biology Technology:Distinguished Scientist H. Mario Geysen Joins SRI International to Lead Combinatorial Sciences and Metabolic Diseases Research Programs 2Distinguished Scientist H. Mario Geysen Joins SRI International to Lead Combinatorial Sciences and Metabolic Diseases Research Programs 3PDL BioPharma Announces Exchange to Retire 2.00% Convertible Senior Notes Due February 15, 2012 2PDL BioPharma Announces Exchange to Retire 2.00% Convertible Senior Notes Due February 15, 2012 3Ardea Biosciences to Present at the Oppenheimer 21st Annual Healthcare Conference 2
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
... antibody raised against a partial ... Immunogen: PPP4C (NP_002711, 218 ... recombinant protein with GST tag. ... NM_002720 ...
Biology Products: