Navigation Links
Mighty mesh
Date:1/23/2012

Cambridge, Mass. - January 23, 2012 - New research at Harvard explains how bacterial biofilms expand to form slimy mats on teeth, pipes, surgical instruments, and crops.

Through experiment and mathematical analysis, researchers have shown that the extracellular matrix (ECM), a mesh of proteins and sugars that can form outside bacterial cells, creates osmotic pressure that forces biofilms to swell and spread.

The ECM mechanism is so powerful that it can increase the radius of some biofilms five-fold within 24 hours.

The results have been published in the Proceedings of the National Academy of Sciences.

Biofilms, large colonies of bacteria that adhere to surfaces, can be harmful in a wide range of settings, resulting in tooth decay, hospital infections, agricultural damage, and corrosion. Finding ways to control or eliminate biofilms is a priority for many industries.

In order for a biofilm to grow, a group of bacterial cells must first adhere to a surface and then proliferate and spread. When a vast number of cells are present, this can translate into the creation of a filmy surface spanning several meters.

"Our work challenges the common picture of biofilms as sedentary communities by showing how cells in a biofilm cooperate to colonize surfaces," says lead author Agnese Seminara, a research associate at the Harvard School of Engineering and Applied Sciences (SEAS).

Several types of biofilms have been characterized based on composition and antibiotic resistance, but until now it has not been clear what roles the whip-like flagella and the ECM play in the outward movement of cells.

While the presence of a flagellum has traditionally been associated with greater movement capability, the new research has found that a flagellum actually confers little advantage in the formation of biofilms. In the Harvard study, mutant bacteria lacking flagella were able to spread at almost the same
'/>"/>

Contact: Caroline Perry
cperry@seas.harvard.edu
617-496-1351
Harvard University
Source:Eurekalert  

Page: 1 2 3

Related biology news :

1. Fit females make more daughters, mighty males get grandsons
2. Simple little spud helps scientists crack potatos mighty genome
3. Mighty predatory mite and oil sprays may save eggplant production in Micronesia
4. Humans have a mighty bite
5. Mighty diatoms: Global climate feedback from microscopic algae
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
Mighty mesh
(Date:6/18/2013)... It,s not a hacker lab. At Brandeis University, ... units are helping scientists understand the complex interplay ... of the virus, outer "shell" critical for ... of what we are finding will help researchers ... says post-doctoral fellow Jason Perlmutter, first author of ...
(Date:6/18/2013)... 2013: The Association for Molecular Pathology is proud to ... for Experimental Biology (FASEB) on July 1, 2013. The ... 3, 2013. , The 26 constituent societies of ... common vision for the advancement of research and education ... research is more important now than ever," said Jennifer ...
(Date:6/18/2013)... New research from the University of Adelaide shows that ... a baby,s life is linked to a higher IQ at early ... Public Health researchers, who analysed data from more than 13,800 children ... Pediatrics , show that babies who put on ... IQ 1.5 points higher by the time they were six years ...
Breaking Biology News(10 mins):Computer modeling technique goes viral at Brandeis 2IQ link to baby's weight gain in first month 2
... OAK RIDGE, Tenn., Sept. 9, 2010 -- Exemplary ... have resulted in a 2010 Federal Energy & Water ... Award in recognition of the lab,s Sustainable Campus Initiative. ... DOE,s Federal Energy Management Program recognized ORNL for its ...
... WI, SEPTEMBER 9, 2010 The American Society of ... 2010 Awards Ceremony on Nov. 2 during the scientific ... . The annual awards are presented for outstanding contributions ... research. , Alan Blaylock, Agrium Advanced Technologies ...
... New Rochelle, NY, September 9, 2010A subset of ... associated with more illness and greater allergic hypersensitivity, ... Blood, and Lung Institute,s Severe Asthma Research Program ... Pediatric Allergy, Immunology, and Pulmonology , a ...
Cached Biology News:ORNL wins 2 awards for sustainability program 2American Society of Agronomy announces award recipients 2American Society of Agronomy announces award recipients 3American Society of Agronomy announces award recipients 4Research and insights on severe asthma in children 2
(Date:6/18/2013)... WILMINGTON, Delaware , June 18, 2013 /PRNewswire/ ... to announce the release of the HELM biomolecular ... permissive open source MIT licence. HELM ... of a wide range of biomolecules (e.g. proteins, ... render existing small-molecule and sequence-based informatics methodologies impractical ...
(Date:6/18/2013)... -- The "Bioinformatics Market By Sector (Molecular Medicine, Agriculture, ... Data Analysis Services) & Application (Genomics, Proteomics & Drug Design) - Global ... Restraints, and Opportunities in North America , ... and Rest of World. Browse , ... Figures 364 Pages and an in-depth ...
(Date:6/18/2013)... , June 18, 2013 ... ) has announced the addition of the ... and Companies " to their offering. ... report briefly reviews basics of human genome ... applications. Current large and small sequencers are ...
(Date:6/18/2013)... DUBLIN , June 18, 2013 ... Markets ( http://www.researchandmarkets.com/research/cmbgcv/north_american ) has announced ... American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes ... Radiation Therapy (I131, Y-90)], [Applications (Cancer/Oncology, ... to 2017" report to their ...
Breaking Biology Technology:The Pistoia Alliance Releases HELM Biomolecular Representation Standard Open Source Tools 2Bioinformatics Market Worth $7.5 Billion by 2017 2Bioinformatics Market Worth $7.5 Billion by 2017 3DNA Sequencing: Technologies, Markets and Companies - 2013 Report 2North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017 2North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017 3
... ROCKVILLE, Md., July 21 Novavax, Inc. (Nasdaq: ... J. Trizzino as Senior Vice President, International and Government Alliances, ... directly to Dr. Rahul Singhvi, Novavax,s President and Chief Executive ... international alliances with pharmaceutical companies and all governmental agencies, including ...
... NEW YORK, July 21 /PRNewswire-Asia-FirstCall/ -- American ... Company" or "AOBO"), a pharmaceutical,company dedicated to improving ... broad range of prescription and over the counter ... honorably elected as one of,the "Top 20 Most ...
... , PALO ALTO, Calif., July 21, Varian, ... quarter of its fiscal year 2009 after 1:00 p.m. Pacific Time (PT) ... its investor conference call to review those quarterly results is scheduled to ... , That live webcast can be accessed from Varian, Inc.,s ...
Cached Biology Technology:Novavax Announces Appointment of John J. Trizzino as Senior Vice President, International and Government Alliances 2American Oriental Bioengineering Honorably Elected a Top 20 Most Competitive Public Pharmaceutical Company in China 2
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...
... The user-friendly Eppendorf Thermomixer R offers ... that require shaking, heating, and cooling. ... expanded its application and temperature control ... each accommodate 24 micro test tubes, ...
...
Biology Products: