Navigation Links
Microbial communities shifted dramatically after Deepwater Horizon spill
Date:6/8/2012

DURHAM, N.H. Communities of microbial organisms -- species such as nematodes, protists and fungi -- on beaches along the Gulf of Mexico changed significantly following the Deepwater Horizon oil spill in April 2010, research from the University of New Hampshire's Hubbard Center for Genome Studies (HCGS) and partners found. The findings, which analyzed marine sediments from five Gulf Coast sites prior to and several months following shoreline oiling, are published in the June 6, 2012, issue of the journal PLoS ONE.

The researchers sampled sites around Dauphin Island, Ala., and Grand Isle, La., just after the Deepwater Horizon spill began but before oil reached the shore, then again several months later, in September 2010.

"In that short time period, we saw a drastic change in the microbial community," says lead author Holly Bik, a postdoctoral researcher at UNH's HCGS when the research was conducted, now at the Genome Center at the University of California, Davis. "We were shocked at how drastic the change was, pre- and post-spill."

Bik and senior author W. Kelley Thomas, director of the HCGS, as well as collaborators from Auburn University and the University of Texas, San Antonio, found that the communities of microbial eukaryotes (organisms not visible to the naked eye whose cells contain nuclei) in the sediments shifted dramatically from highly diverse communities dominated by nematodes "what you would expect on a beach," says Bik -- to an almost exclusively fungal community.

What's more, those post-spill fungi seem to have an appetite for oil. "The fungal taxa that were there were previously associated with hydrocarbons," Bik says, noting that the group of fungi sampled post-spill from the Grand Isle sites are suspected to utilize hydrocarbons and thrive in hostile, polluted conditions that appear to be intolerable for other marine fungi.

The researchers used two parallel methodologies high-throughpu
'/>"/>

Contact: Beth Potier
beth.potier@unh.edu
603-862-1566
University of New Hampshire
Source:Eurekalert  

Page: 1 2

Related biology news :

1. Ozone treated water v. lethal microbial material
2. New synthetic biology technique boosts microbial production of diesel fuel
3. Report details efforts to improve, advance indoor microbial sampling
4. Keck award enables Carnegie Mellon and Stanford to dramatically expand crowdsourced RNA design
5. Nanotechnology breakthrough could dramatically improve medical tests
6. 1 year after Fukushima
7. AGU: Venice hasnt stopped sinking after all
8. Black flies may have a purpose after all
9. Estrogen hormone reveals protective ability after traumatic brain injury
10. Obstructive sleep apneas damage evident after 1 month
11. Scientists read the ash from the Icelandic volcano 2 years after its eruption
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
Microbial communities shifted dramatically after Deepwater Horizon spill
(Date:6/19/2013)... Course at the Marine Biological Laboratory (MBL), Woods ... Microbiology site by the American Society for Microbiology ... recognizes institutions and the scientists who worked there ... science of microbiology. A ceremony unveiling the ... for Saturday, June 22, 2013, at 4:30 pm ...
(Date:6/19/2013)... University of Pittsburgh has developed antibacterial compounds, derived ... be potential treatments for drug-resistant bacterial infections and ... are quite small, making them inexpensive and easy ... June 2013 issue of the journal Antimicrobial ... many probable applications will likely be the chronic ...
(Date:6/19/2013)... June 19, 2013 A decade-long JDRF-funded study ... Helmholtz Zentrum Mnchen, Germany, is providing a deeper ... risk of developing type 1 diabetes (T1D), highlighting ... for the disease. The study, "Seroconversion to Multiple ... in Children," was published today in The ...
Breaking Biology News(10 mins):Microbial diversity course designated as a 'Milestones in Microbiology' site 2HIV-derived antibacterial shows promise against drug-resistant bacteria 2New data on islet autoantibodies in young children defines early type 1 diabetes development 2
... that the loss of a gene called p63 accelerates aging ... many organisms, including humans. Therefore, the p63 gene is likely ... "To study how the p63 gene works, we devised a ... us right away was that these p63 deficient mice were ...
... study has followed a single humpback whale from one ... the migratory patterns of these majestic marine mammals in ... Society (WCS), the American Museum of Natural History (AMNH), ... Society's Biology Letters, a male humpback whale that was ...
... the introduction of the varicella (chicken pox) vaccine in ... have dropped dramatically, according to a study in the ... recommended for routine immunization of children aged 12 to ... in the United States, according to background information in ...
Cached Biology News:Gene loss accelerates aging 2Genetics links whale to two different ocean basins 2Hospitalizations because of chicken pox down dramatically since implementation of vaccine 2Hospitalizations because of chicken pox down dramatically since implementation of vaccine 3
(Date:6/19/2013)... , June 19, 2013 ... ) has announced the addition of the ... Opportunities, 2018" report to their offering. ... Lack of data protection and old ... PIN codes have driven the growth of ...
(Date:6/19/2013)... -- Continuing its long history of proven clinical performance in ... Inc. announces the U.S. Food and Drug Administration (FDA) ... assay for use on its Access 2 immunoassay system. ... Coulter,s troponin I test for over 12 years ... to continue providing dependability to laboratories supporting emergency care," ...
(Date:6/19/2013)... 2013 Biotechnology industry pioneer Amgen (NASDAQ: ... provider BlackLine Systems  and enterprise application software leader ... a webinar next week entitled "No Account Left Behind!  ... SAP to Help Keep Its Account Reconciliations in Good Shape ... The webinar, geared at finance, accounting, audit and ...
(Date:6/19/2013)... (PRWEB) June 19, 2013 Applied Rigaku ... report that details the measurement of sulfur in ultra-low ... QC+ high resolution benchtop EDXRF analyzer . The analysis ... test method ISO 13032. This International Standard specifies ... the determination of sulfur content in automotive gasoline. , ...
Breaking Biology Technology:Global Biometric Systems Market Forecast Report - Opportunities to 2018 2Global Biometric Systems Market Forecast Report - Opportunities to 2018 3Beckman Coulter Announces FDA Clearance of New Access AccuTnI+3 Troponin I Assay for the Access 2 Immunoassay System 2Beckman Coulter Announces FDA Clearance of New Access AccuTnI+3 Troponin I Assay for the Access 2 Immunoassay System 3Amgen Joins BlackLine Systems, SAP for Webinar on Automating Account Reconciliations 2Amgen Joins BlackLine Systems, SAP for Webinar on Automating Account Reconciliations 3Amgen Joins BlackLine Systems, SAP for Webinar on Automating Account Reconciliations 4Rigaku Publishes New Application Note for Analysis of ULSD Per ISO 13032 2
... Calif., May 8 Edwards Lifesciences,Corporation (NYSE: EW ... valves,announced that the company will celebrate a number of ... meeting of the American,Association for Thoracic Surgery (AATS), May ... by Edwards -- which this year celebrates,its 50th anniversary ...
... ALTO, Calif., May 8 Telik, Inc. (Nasdaq:,TELK) today ... per share, for,the first quarter ended March 31, 2008, ... per share, for the comparable period in 2007., ... costs and,expenses were $10.6 million, compared with $18.0 million ...
... Md., May 8 The Maryland Stem Cell,Research ... 122,applications in response to its three official Requests ... Maryland Technology Development,Corporation (TEDCO) reviewed the Commission,s recommendations ... Maryland Stem Cell Research,Fund (MSCRF) under the Maryland ...
Cached Biology Technology:Edwards Lifesciences Celebrates One Million Heart Valve Patients and More at AATS 2008 2Edwards Lifesciences Celebrates One Million Heart Valve Patients and More at AATS 2008 3Edwards Lifesciences Celebrates One Million Heart Valve Patients and More at AATS 2008 4Telik Announces First Quarter 2008 Financial Results 2Telik Announces First Quarter 2008 Financial Results 3Maryland Stem Cell Research Commission Recommends 62 Projects for Funding 2Maryland Stem Cell Research Commission Recommends 62 Projects for Funding 3
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products: