Navigation Links
MSU researchers testing vaccine to help people quit smoking
Date:5/21/2010

EAST LANSING, Mich. In a unique twist to a decades-old health crisis, Michigan State University researchers are testing a new vaccine to help people quit smoking and avoid relapses.

Using a vaccine as opposed to patches or gums, which attempt to wean people off nicotine is a novel approach to the addiction that results in more than $192 billion in health care costs each year, according to federal estimates.

The vaccine, called NicVAX, is being developed and manufactured by Nabi Biopharmaceuticals of Rockville, Md. It will be tested at 25 sites nationwide.

Jonathan Henry, an associate professor with MSU's Department of Psychiatry and the Clinical and Translational Sciences Institute, is leading the clinical trial at MSU.

"Using a vaccine to treat nicotine dependence is one of the most unique approaches to battling addiction," Henry said. "We are very hopeful this strategy will help smokers kick the habit."

The vaccine works by preventing a smoker from "feeling good" while smoking. When nicotine enters the bloodstream, it quickly crosses the blood-brain barrier, triggering the release of stimulants such as dopamine that provide the smoker with a positive sensation, eventually leading to addiction.

NicVAX stimulates the immune system to produce antibodies that bind with and prevent nicotine from crossing the blood-brain barrier, essentially preventing the highly-addictive pleasure sensation experienced by smokers.

Vaccine developers hope that prevention helps people quit smoking, and because the antibodies remain in the bloodstream for several months, the vaccine could be effective in preventing relapse. With current smoking-cessation therapies, relapse rates can be as high as 90 percent in the first year after a smoker quits.

During the clinical trial, participants will receive the vaccine several times throughout a 12-month period. Results from the placebo-controlled study are expected
'/>"/>

Contact: Jason Cody
codyja@msu.edu
517-432-0924
Michigan State University
Source:Eurekalert

Page: 1 2

Related biology news :

1. OU WaTER Center researchers providing solutions in developing countries
2. Researchers embark on work to control the prion epidemic affecting deer in the USA
3. Are invasives bad? Not always, say Brown researchers
4. UGA researchers use patented SERS technique to rapidly, accurately detect rotavirus strain
5. 700 international researchers gather for Great Lakes Research Conference
6. Biofuel chemistry more complex than petroleum, say Sandia and Lawrence Livermore researchers
7. Researchers share insights into RNA
8. UT Southwestern researchers find mechanism that may stop E. coli from developing in cattle
9. A new effective strategy for treating tobacco addiction was developed by researchers from the CAS
10. Researchers offer first proof that chemicals from seaweeds damage coral on contact
11. UNC researchers receive $100,000 Grand Challenges Exploration Grant to develop male contraceptive
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/18/2013)... It,s not a hacker lab. At Brandeis University, ... units are helping scientists understand the complex interplay ... of the virus, outer "shell" critical for ... of what we are finding will help researchers ... says post-doctoral fellow Jason Perlmutter, first author of ...
(Date:6/18/2013)... 2013: The Association for Molecular Pathology is proud to ... for Experimental Biology (FASEB) on July 1, 2013. The ... 3, 2013. , The 26 constituent societies of ... common vision for the advancement of research and education ... research is more important now than ever," said Jennifer ...
(Date:6/18/2013)... New research from the University of Adelaide shows that ... a baby,s life is linked to a higher IQ at early ... Public Health researchers, who analysed data from more than 13,800 children ... Pediatrics , show that babies who put on ... IQ 1.5 points higher by the time they were six years ...
Breaking Biology News(10 mins):Computer modeling technique goes viral at Brandeis 2IQ link to baby's weight gain in first month 2
... OAK RIDGE, Tenn., Sept. 9, 2010 -- Exemplary ... have resulted in a 2010 Federal Energy & Water ... Award in recognition of the lab,s Sustainable Campus Initiative. ... DOE,s Federal Energy Management Program recognized ORNL for its ...
... WI, SEPTEMBER 9, 2010 The American Society of ... 2010 Awards Ceremony on Nov. 2 during the scientific ... . The annual awards are presented for outstanding contributions ... research. , Alan Blaylock, Agrium Advanced Technologies ...
... New Rochelle, NY, September 9, 2010A subset of ... associated with more illness and greater allergic hypersensitivity, ... Blood, and Lung Institute,s Severe Asthma Research Program ... Pediatric Allergy, Immunology, and Pulmonology , a ...
Cached Biology News:ORNL wins 2 awards for sustainability program 2American Society of Agronomy announces award recipients 2American Society of Agronomy announces award recipients 3American Society of Agronomy announces award recipients 4Research and insights on severe asthma in children 2
(Date:6/18/2013)... WILMINGTON, Delaware , June 18, 2013 /PRNewswire/ ... to announce the release of the HELM biomolecular ... permissive open source MIT licence. HELM ... of a wide range of biomolecules (e.g. proteins, ... render existing small-molecule and sequence-based informatics methodologies impractical ...
(Date:6/18/2013)... -- The "Bioinformatics Market By Sector (Molecular Medicine, Agriculture, ... Data Analysis Services) & Application (Genomics, Proteomics & Drug Design) - Global ... Restraints, and Opportunities in North America , ... and Rest of World. Browse , ... Figures 364 Pages and an in-depth ...
(Date:6/18/2013)... , June 18, 2013 ... ) has announced the addition of the ... and Companies " to their offering. ... report briefly reviews basics of human genome ... applications. Current large and small sequencers are ...
(Date:6/18/2013)... DUBLIN , June 18, 2013 ... Markets ( http://www.researchandmarkets.com/research/cmbgcv/north_american ) has announced ... American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes ... Radiation Therapy (I131, Y-90)], [Applications (Cancer/Oncology, ... to 2017" report to their ...
Breaking Biology Technology:The Pistoia Alliance Releases HELM Biomolecular Representation Standard Open Source Tools 2Bioinformatics Market Worth $7.5 Billion by 2017 2Bioinformatics Market Worth $7.5 Billion by 2017 3DNA Sequencing: Technologies, Markets and Companies - 2013 Report 2North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017 2North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017 3
... ROCKVILLE, Md., July 21 Novavax, Inc. (Nasdaq: ... J. Trizzino as Senior Vice President, International and Government Alliances, ... directly to Dr. Rahul Singhvi, Novavax,s President and Chief Executive ... international alliances with pharmaceutical companies and all governmental agencies, including ...
... NEW YORK, July 21 /PRNewswire-Asia-FirstCall/ -- American ... Company" or "AOBO"), a pharmaceutical,company dedicated to improving ... broad range of prescription and over the counter ... honorably elected as one of,the "Top 20 Most ...
... , PALO ALTO, Calif., July 21, Varian, ... quarter of its fiscal year 2009 after 1:00 p.m. Pacific Time (PT) ... its investor conference call to review those quarterly results is scheduled to ... , That live webcast can be accessed from Varian, Inc.,s ...
Cached Biology Technology:Novavax Announces Appointment of John J. Trizzino as Senior Vice President, International and Government Alliances 2American Oriental Bioengineering Honorably Elected a Top 20 Most Competitive Public Pharmaceutical Company in China 2
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...
... The user-friendly Eppendorf Thermomixer R offers ... that require shaking, heating, and cooling. ... expanded its application and temperature control ... each accommodate 24 micro test tubes, ...
...
Biology Products: