Navigation Links
MIT researchers study the danger of toxoplasma parasites
Date:1/4/2011

CAMBRIDGE, Mass. -- About one-third of the human population is infected with a parasite called Toxoplasma gondii, but most of them don't know it. Though Toxoplasma causes no symptoms in most people, it can be harmful to individuals with suppressed immune systems, and to fetuses whose mothers become infected during pregnancy. Toxoplasma spores are found in dirt and easily infect farm animals such as cows, sheep, pigs and chickens. Humans can be infected by eating undercooked meat or unwashed vegetables.

Jeroen Saeij, an assistant professor of biology at MIT is investigating a key question: why certain strains of the Toxoplasma parasite (there are at least a dozen) are more dangerous to humans than others. He and his colleagues have focused their attention on the type II strain, which is the most common in the United States and Europe, and is also the most likely to produce symptoms. In a paper appearing in the Jan. 3 online edition of the Journal of Experimental Medicine, the researchers report the discovery of a new Toxoplasma protein that may help explain why type II is more virulent than others.

Toxoplasma infection rates vary around the world. In the United States, it's about 10 to 15 percent, while rates in Europe and Brazil are much higher, around 50 to 80 percent. However, these are only estimates it is difficult to calculate precise rates because most infected people don't have any symptoms.

After an infection is established, the parasite forms cysts, which contain many slowly reproducing parasites, in muscle tissue and the brain. If the cysts rupture, immune cells called T cells will usually kill the parasites before they spread further. However, people with suppressed immune systems, such as AIDS patients or people undergoing chemotherapy, can't mount an effective defense.

"In AIDS patients, T cells are essentially gone, so once a cyst ruptures, it can infect more
'/>"/>

Contact: Jessica Holmes
holmesj@mit.edu
617-253-2702
Massachusetts Institute of Technology
Source:Eurekalert

Page: 1 2

Related biology news :

1. NC State researchers get to root of parasite genome
2. Researchers find animal with ability to survive climate change
3. Researchers find an essential gene for forming ears of corn
4. Researchers note differences between people and animals on calorie restriction
5. Researchers study acoustic communication in deep-sea fish
6. Researchers discover that growing up too fast may mean dying young in honey bees
7. Researchers study how pistachios may improve heart health
8. UI researchers find potentially toxic substance present in Chicago air
9. Researchers develop new self-training gene prediction program for fungi
10. Case Western Reserve University researchers track Chernobyl fallout
11. Childrens National researchers develop novel anti-tumor vaccine
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:8/28/2014)... (Maximizing Access to Research Careers) Program has announced ... of America,s 27th Annual Mouse Molecular Genetics Conference ... Pacific Grove, California. These awards are meant ... and scientists from underrepresented groups into the mainstream ... the participation of young scientists at the Genetics ...
(Date:8/28/2014)... Advocate and Senior Staff Attorney at the Electronic Frontier ... of biometric and mobile commerce experts set to speak ... Tampa, Florida on September 15, ... Rahman, Director, Technology and Strategy at Samsung, and Philippe de ... this year,s event is Mobility at the Crossroads of ...
(Date:8/28/2014)... good examples of complex systems. Their infrastructure equipment ... for cooling, transport to supply fuel, and ICT ... the network chain is interconnected with a wider ... team of UK-based scientists has studied various aspects ... have been published in EPJ B by Gaihua ...
Breaking Biology News(10 mins):Biometrics UnPlugged Welcomes the Electronic Frontier Foundation's Jennifer Lynch to the Mobility at the Crossroads of Commerce and Privacy Summit 2Inter-dependent networks stress test 2
... and Rongchao Jin have successfully used NMR to ... could advance the development and use of the ... approach offers a significant advantage over routine methods ... whether the nanoparticles exist in a both right-handed ...
... School have made an important discovery about the mechanism ... our understanding of how proteins regulate appetite control and ... Head of Metabolic and Vascular Health at Warwick Medical ... 1A, (CPT1) has a switch which is thrown depending ...
... aconites are plants, widely cultivated for their beauty and ... natural group of 650-700 species ranging from Eurasia into ... mountains. The study was published in the open access ... sampled molecular phylogeny for this group has revealed that ...
Cached Biology News:Carnegie Mellon researchers use NMR to determine whether gold nanoparticles exhibit 'handedness' 2Carnegie Mellon researchers use NMR to determine whether gold nanoparticles exhibit 'handedness' 3
(Date:8/28/2014)... -- Next month, executives from clinical trial marketing firm BBK Worldwide ... Patient-Centered Clinical Trials 2014 , to be held at ... September 4-5. Patient recruitment experts Bonnie A. Brescia , ... share insights on the benefits of employing an effective patient ... media to mobile apps – can be used to drive ...
(Date:8/28/2014)... 28, 2014  Armetheon, Inc. ( www.armetheon.com ), ... to late-stage cardiovascular drug candidates, today announced that ... round of financing. The Series A round was ... with participation from investors that included Atheneos Capital ... Larry Hsu , the founder of Impax ...
(Date:8/28/2014)... Vt. (PRWEB) August 28, 2014 ... testing around the world is available from Strategic ... diagnostics companies. “ Industrial Microbiology Market Review, Fourth ... Industrial Market ” (IMMR—4) tracks and compares microbiology ... in North America, Europe and Asia, and forecasts ...
(Date:8/28/2014)... San Diego, CA (PRWEB) August 28, 2014 ... products, Pipette.com is offering a promotion for ... enables Pipette.com customers to purchase the highest quality ... Centrifuge Tubes are ideal for customers doing chemical, ... benefit lab technicians who are not regularly able ...
Breaking Biology Technology:BBK Worldwide Leads Sessions at Key September Events 2Armetheon Completes $7.0 Million Series A Financing 2Armetheon Completes $7.0 Million Series A Financing 32 Billion Industrial Microbiology Tests Conducted for Product Quality and Safety Worldwide 22 Billion Industrial Microbiology Tests Conducted for Product Quality and Safety Worldwide 3Eppendorf Safe Lock Centrifuge Tube Promotion Now Available at Major Pipette Distributor Pipette.com 2Eppendorf Safe Lock Centrifuge Tube Promotion Now Available at Major Pipette Distributor Pipette.com 3
... DIEGO, June 8 , , WHO: ... and panelists discussing life sciences and the business relationships between California ... , CALAsia is an international 2-day forum that will bring ... Asia Pacific region to identify, explore, and further trans-Pacific business endeavors. ...
... International, a leader in enabling and accelerating the global ... today announced a strategic drug co-development partnership with the ... of therapeutic areas and represents one of the first ... company and a Chinese university. , , HUYA ...
... June 8 CSL Limited (ASX: CSL) and Talecris Biotherapeutics, ... their merger agreement, announced on August 12, 2008, under which ... , , Dr. Brian McNamee, CEO and Managing Director ... Federal Trade Commission (FTC) resolved to block the transaction. ...
Cached Biology Technology:BIOCOM's Inaugural CALAsia Forum 'Bridging the Pacific' 2HUYA Bioscience Announces Strategic Collaboration With the Shenyang Pharmaceutical University 2HUYA Bioscience Announces Strategic Collaboration With the Shenyang Pharmaceutical University 3CSL Limited and Talecris Biotherapeutics Agree to Terminate Merger Agreement 2CSL Limited and Talecris Biotherapeutics Agree to Terminate Merger Agreement 3
Mouse monoclonal antibody raised against a partial recombinant DENR. NCBI Entrez Gene ID = DENR...
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
... raised against a partial recombinant NFKBIB. ... 145 a.a) partial recombinant protein with GST tag. ... Accession: BC015528 ... OMIM: 604495, GeneID: ...
... Mouse polyclonal antibody raised against a ... FES (AAH35357, 120 a.a. ~ 250 ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: