Navigation Links
LungPoint system results presented at American Thoracic Society 2010 International Conference
Date:5/17/2010

d not normally be accessible by standard bronchoscopy. This is significant because it translates into earlier diagnosis and treatment for cancer patients."

More about the LungPoint System

Pulmonologists use bronchoscopes every day to examine and perform medical procedures in a patient's lungs. The LungPoint Planning and Virtual Bronchoscopic Navigation systems are used to plan and guide bronchoscopic procedures such as lung biopsies and fiducial marker placement. The software gives the physician tools to look at the lungs and airways in three dimensions, resulting in more effective treatment planning and execution. During bronchoscopy, the planned virtual path is compared to the live bronchoscope video images, indicating to the physician the correct airway to follow for optimal biopsy accuracy.


'/>"/>

Contact: Meghan Oreste
megoreste@gmail.com
617-823-1441
Broncus Technologies
Source:Eurekalert  

Page: 1 2 3

Related biology news :

1. Bursts of waves drive immune system soldiers toward invaders
2. Bioengineers at University of Pennsylvania devise nanoscale system to measure cellular forces
3. Obesity and the central nervous system -- the state of the art
4. How the plant immune system can drive the formation of new species
5. Upgraded IMG 2.3 Data Management System released by DOE JGI to eager user community
6. Systems Biology poised to revolutionize the understanding of cell function and disease
7. Europe needs collective effort on System Biology, says ESF Task Force
8. Cogent Systems and Northrop Grumman Reach Agreement to Settle Automated Fingerprint Identification Technology Suit and Create Strategic Alliance
9. Radiant Systems Selects BIO-key(R) Biometric Software for POS Solution
10. Fujitsu and HT Systems Partner to Provide Biometric Patient Identity Management
11. Fujitsu and HT Systems Partner to Provide Biometric Patient Identity Management
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
LungPoint system results presented at American Thoracic Society 2010 International Conference
(Date:3/12/2015)... March 12, 2015 The mascots of the ... Hospital, part of Wake Forest Baptist Medical Center. They ... the 2015 ACC Men,s Basketball Tournament. Young patients enjoyed ... and getting their autographs. Brenner Children,s Hospital ... is the only children,s hospital in northwest ...
(Date:3/11/2015)...   The Sync Project™ today announced ... and harness music to improve health. The platform ... measurements of physiology, enabling the study of the ... populations. It is designed for medical and health ... studies and accelerate the discovery of the clinical ...
(Date:3/10/2015)...  NXT-ID, Inc. (NASDAQ: NXTD ... authentication company focused on the growing mobile commerce ... been named the "Number One Best Tech Gift ... Modern ( http://www.rethinkmodern.com/ ) is a web magazine focused ... that have a unique function or design.  ...
Breaking Biology News(10 mins):Introducing The Sync Project, a Global Collaboration Harnessing the Scientific Potential of Music for Health 2Introducing The Sync Project, a Global Collaboration Harnessing the Scientific Potential of Music for Health 3NXT-ID's Wocket Smart Wallet Named Number One Best Tech Gift for 2015 by Rethink Modern 2NXT-ID's Wocket Smart Wallet Named Number One Best Tech Gift for 2015 by Rethink Modern 3NXT-ID's Wocket Smart Wallet Named Number One Best Tech Gift for 2015 by Rethink Modern 4
... MADISON, WI, SEPTEMBER 21, 2009 A new ... , documents the history, science, and applications of tall ... increasing role in protecting soil and water and enhancing ... from around the world who address an array of ...
... after plucking the fossilized tooth of a new human ... team of scientists today (Thursday, Oct. 1) announced their ... Ardipithecus ramidus , which they say revolutionizes our understanding ... female skeleton, nicknamed Ardi, is 4.4 million years old, ...
... African bees were accidentally released in Brazil in 1957. ... at the Smithsonian Tropical Research Institute, began a 17-year ... to native bees than changes in the weather and ... , Scientists feared that dangerous swarms of Africanized bees ...
Cached Biology News:Tall fescue's future in agriculture 2Ardi displaces Lucy as oldest hominid skeleton 2Ardi displaces Lucy as oldest hominid skeleton 3Ardi displaces Lucy as oldest hominid skeleton 4Ardi displaces Lucy as oldest hominid skeleton 5Killer bees may increase food supplies for native bees 2
(Date:3/26/2015)... LANSING, Mich., March 26, 2015 Neogen Corporation ... income for the third quarter of fiscal 2015, which ... to the prior year,s $6,575,000. Earnings per share in ... year ago. Current year-to-date net income increased 17% over ... to $20,621,000, or $0.56 per share, for the same ...
(Date:3/26/2015)... 26, 2015 Ale Gicqueau, Founder and ... of Clinical Affairs at Align Technology, on “ Conducting ... upcoming ACRP 2015 Global Conference and Exhibition on April ... , During the poster presentation, Ale Gicqueau and ... running a Postmarket Registry, the requirements and resources to ...
(Date:3/25/2015)... TORONTO , March 25, 2015 /PRNewswire/ - SQI Diagnostics ... announced that, as a result of recent discussions with ... common shares of the Company, after dealing with certain ... and special meeting of shareholders on March 26, 2015 ... that the election of directors will take place when ...
(Date:3/25/2015)... Laboratory workers can turn to ... Balances to get best-performing features while still remaining ... from the trusted brand include: , Cole-Parmer ... efficiency by providing a large weighing surface for ... include parts counting, percent weighing, checkweighing, animal/dynamic weighing, ...
Breaking Biology Technology:Neogen reports 13% increase in net income 2Neogen reports 13% increase in net income 3Neogen reports 13% increase in net income 4Neogen reports 13% increase in net income 5Neogen reports 13% increase in net income 6Neogen reports 13% increase in net income 7Neogen reports 13% increase in net income 8Clinovo Presents at ACRP 2015 in Salt Lake City, Utah on April 25th-28th 2Clinovo Presents at ACRP 2015 in Salt Lake City, Utah on April 25th-28th 3SQI Diagnostics Inc. Announces New Nominees to SQI Diagnostics Board and Adjournment of Meeting 2SQI Diagnostics Inc. Announces New Nominees to SQI Diagnostics Board and Adjournment of Meeting 3SQI Diagnostics Inc. Announces New Nominees to SQI Diagnostics Board and Adjournment of Meeting 4SQI Diagnostics Inc. Announces New Nominees to SQI Diagnostics Board and Adjournment of Meeting 5New Economical Top-Loading and Analytical Symmetry Balances from Cole-Parmer 2
... -- Engineers at Ohio State University are developing a ... same material found in pencils. , Experts believe that ... graphite pencils -- holds the key to smaller, faster ... could enable new kinds of electronics. , Until now, ...
... March 31 Alseres Pharmaceuticals, Inc. (Nasdaq: ... of the Company,s independent registered public accounting firm ... explanatory paragraph regarding the Company,s ability to continue ... NASDAQ-traded companies to publicly announce if their Annual ...
... after heart attackAUSTIN, Texas, March 31 /PRNewswire/ ... Austin treated the first patient in the world ... test the effectiveness and safety of administering adult stem ... heart attack. Dr. Roger Gammon, a cardiologist with ...
Cached Biology Technology:Researchers find better way to manufacture fast computer chips 2Researchers find better way to manufacture fast computer chips 3Alseres Pharmaceuticals, Inc. Complies with NASDAQ Rule Regarding Recently Filed 10-K 2Alseres Pharmaceuticals, Inc. Complies with NASDAQ Rule Regarding Recently Filed 10-K 3Heart Hospital of Austin First Site in World to Test Efficacy of New Adult Stem Cell Therapy to Treat Damaged Heart Tissue in Phase II Trial 2
... Mouse polyclonal antibody raised against a ... FES (AAH35357, 120 a.a. ~ 250 ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products: