Navigation Links
Living sensor can warn of arsenic pollution
Date:9/7/2008

rn when traces of arsenic are escaping from areas like mine workings, industrial chemical facilities, or even laboratories, alerting us before pollution manages to get into watercourses or drinking water supplies. We could also use it to test newly drilled wells in countries like Bangladesh where water supplies are known to be contaminated," said Thomas Osborne.

Many organisms, including all plants and animals, ultimately get their energy from the sun via photosynthesis. But over the last few decades scientists have discovered more and more microbes that can get their energy directly from breaking down chemical bonds. This enables them to survive in extraordinary and dark environments such as deep inside the Earth or at the bottom of the coldest, deepest oceans, where previously no life was expected to exist at all.


'/>"/>

Contact: Lucy Goodchild
l.goodchild@sgm.ac.uk
44-078-248-83010
Society for General Microbiology
Source:Eurekalert

Page: 1 2

Related biology news :

1. MIT creates 3-D images of living cell
2. Clemson scientists shed light on molecules in living cells
3. Living fossils have hot sex
4. Studying component parts of living cells with carbon nanotube cellular probes
5. Living with lions
6. Burrowing mammals dig for a living, but how do they do that?
7. Researchers examine closest living relative to primates
8. New technology illuminates protein interactions in living cells
9. New technique captures chemical reactions in a single living cell at unprecedented resolution
10. Captive carnivores not up to wild living
11. Stanford researchers say living corals thousands of years old hold clues to past climate changes
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/3/2009)... undergo a personality change in warmer water, according to an ... species more aggressive. , Experiments with two species of young ... first time that some reef fish are either consistently timid, ... more marked as water temperatures rise. , A slight lift ...
(Date:12/3/2009)... included in the design of the upcoming forest deal at ... a scientist at the University of Leeds. , Writing ... at least 50% of the carbon credit payments to be ... and Degredation), should be made to forest dwellers directly, and ...
(Date:12/3/2009)... comes to investment in energy efficient technologies research, but ... Dave Delpy believes that more is needed: "Scientific and ... wind and solar power solutions, but more investment is ... we are to meet our carbon emission targets by ...
Breaking Biology News(10 mins):Fish with attitude: Some like it hot 2Forest deal at Copenhagen must avoid creating 'carbon refugees' 2Research is vital to a cleaner, greener, low carbon future 2Firm Says Low Cost Genome Sequencing Is Possible 60782 1Mom was right 3A Nice guys dont always finish last 60778 1Mom was right 3A Nice guys dont always finish last 60778 2DIA Conference to Explore Components of Risk Management Plans As They Apply to Medicinal Products Therapeutic Biologics and Vaccines 60773 1DIA Conference to Explore Components of Risk Management Plans As They Apply to Medicinal Products Therapeutic Biologics and Vaccines 60773 2DIA Conference to Explore Components of Risk Management Plans As They Apply to Medicinal Products Therapeutic Biologics and Vaccines 60773 3
... CA--Version 2.4 of the Integrated Microbial Genomes (IMG) data ... for microbial genome data analysis, has now been released. ... Institute (DOE JGI), IMG has built a popular following ... offered in Spring 2008, now full. DOE JGI has ...
... various plants, animals and microorganisms, Systems Biology is regarded ... research. Current technologies allow biologists to spell all the ... little in the way of deciphering this complex code. ... give them new tools for use in drug discovery ...
... the new in vitro tests, called the Standard Scrapie ... accurate and extremely rapid way, producing results in less ... Panel Assay, allows researchers to quickly distinguish between several ... assays, the scientists were able to show that four ...
Other Biology News:World class in Systems Biology is the aim 2World class in Systems Biology is the aim 3World class in Systems Biology is the aim 4Scripps scientists develop new tests that identify lethal prion strains quickly and accurately 2
(Date:12/3/2009)... Dec. 3 VIA Pharmaceuticals, Inc. (Nasdaq: VIAP ... compounds for the treatment of cardiovascular and metabolic disease, ... visit in its Phase 2 FDG-PET clinical trial of ... and was carried out at five sites in the ...
(Date:12/3/2009)... 3 Inverness Medical Innovations, Inc. (NYSE: IMA ... of their health at home through the merger of rapid ... per share on its Series B Convertible Perpetual Preferred Stock ... Series B stock in an amount per share equal to ...
(Date:12/2/2009)... COLUMBIA, Md., Dec. 2 Martek Biosciences Corporation (Nasdaq: ... results of its fourth quarter and fiscal year 2009 on ... Following the release, at 4:45 p.m. ET Martek will ... All interested parties may listen to the call live ...
(Date:12/2/2009)... Reportlinker.com announces that a new market research ... Carbondioxide Incubators - A Global Market ... ,, Incubators are the most critical equipment ... other applications for providing a controlled environment ...
Breaking Biology Technology:VIA Pharmaceuticals Completes Patient Visits in Phase 2 Trial of VIA-2291 2VIA Pharmaceuticals Completes Patient Visits in Phase 2 Trial of VIA-2291 3VIA Pharmaceuticals Completes Patient Visits in Phase 2 Trial of VIA-2291 4Martek to Announce Fourth Quarter and Fiscal Year 2009 Results 2Reportlinker Adds Carbondioxide Incubators - A Global Market Perspective 2Reportlinker Adds Carbondioxide Incubators - A Global Market Perspective 3Reportlinker Adds Carbondioxide Incubators - A Global Market Perspective 4
... Net Results Improve for Year on Higher Services ... Digirad Corporation,(Nasdaq: DRAD ), a leading ... physicians, offices, hospitals and imaging centers, today,reported narrower ... 2007, on,higher annual revenues and lower operating expenses ...
... DIEGO, Feb. 7 ADVENTRX Pharmaceuticals,Inc. (Amex: ... pharmacokinetic data from,the Company,s marketing-enabling bioequivalence clinical ... for presentation at the 2008,American Association for ... April 12 - 16, 2008 in San ...
... Neal Skipper and Franco Cacialli, of the London ... Physics & Astronomy, University College London (UCL), have ... help them develop alternative fuel supplies for transport ... grant, with funding from the Wolfson Foundation under ...
Other Biology Technology:Digirad Corporation Reports Financial Results for 2007 Fourth Quarter and Twelve Months 2Digirad Corporation Reports Financial Results for 2007 Fourth Quarter and Twelve Months 3Digirad Corporation Reports Financial Results for 2007 Fourth Quarter and Twelve Months 4Digirad Corporation Reports Financial Results for 2007 Fourth Quarter and Twelve Months 5Digirad Corporation Reports Financial Results for 2007 Fourth Quarter and Twelve Months 6Digirad Corporation Reports Financial Results for 2007 Fourth Quarter and Twelve Months 7ADVENTRX to Present Complete ANX-530 Pharmacokinetic Data at the 2008 American Association for Cancer Research Annual Meeting 2ADVENTRX to Present Complete ANX-530 Pharmacokinetic Data at the 2008 American Association for Cancer Research Annual Meeting 3New funding to charge energy research at UCL and the London Centre for Nanotechnology 2
... & SSM4, Small space saving design - ideal ... of two models: , - 3D gyratory action ... , Digital speed control and built-in timer , Optional ... rockers are ideal where gentle mixing is required, either ...
...
... Mouse monoclonal antibody raised against a partial recombinant ... 358 a.a. ~ 457 a.a) partial recombinant protein ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
Mouse monoclonal antibody raised against a full length recombinant PPIL2. NCBI Entrez Gene ID = PPIL2...
Biology Products: