Navigation Links
Large international study finds memory in adults impacted by versions of 4 genes
Date:4/15/2012

(SACRAMENTO, Calif.) -- Two research studies, co-led by UC Davis neurologist Charles DeCarli and conducted by an international team that included more than 80 scientists at 71 institutions in eight countries, has advanced understanding of the genetic components of Alzheimer's disease and of brain development. Both studies appear in the April 15 edition of the journal Nature Genetics.

The first study, based on a genetic analysis of more than 9,000 people, has found that certain versions of four genes may speed shrinkage of a brain region involved in making new memories. The brain area, known as the hippocampus, normally shrinks with age, but if the process speeds up, it could increase vulnerability to Alzheimer's disease, the research suggests.

The second paper identifies two genes associated with intracranial volume the space within the skull occupied by the brain when the brain is fully developed in a person's lifespan, usually around age 20.

DeCarli is an internationally renowned pioneer in the field of neuroimaging of the aging brain who has been at the forefront of developing and using quantifiable imaging techniques to define the relationship between structure and function in the healthy aging brain and to characterize the changes associated with vascular and Alzheimer's dementias. He is professor of neurology and director of the UC Davis Alzheimer's Disease Center and the UC Davis Imaging of Dementia and Aging Laboratory.

Genetic variants of hippocampus study

The gene variants identified in the first study do not cause Alzheimer's, but they may rob the hippocampus of a kind of "reserve" against the disease, which is known to cause cell destruction and dramatic shrinkage of this key brain site. The result is severe loss of memory and cognitive ability.

Scientists calculated that hippocampus shrinkage in people with these gene variants accelerates by about four years on average. The risk
'/>"/>

Contact: Carole Gan
carole.gan@ucdmc.ucdavis.edu
916-762-2089
University of California - Davis Health System
Source:Eurekalert

Page: 1 2 3 4

Related biology news :

1. Lack of large-scale experiments slows progress of environmental restoration
2. Complete Genomics launches, becomes worlds first large-scale human genome sequencing company
3. Yale journal finds nanomaterials may have large environmental footprint
4. Research uncovers new steps on pathway to enlarged heart
5. Paradigm Tactical Products to be Largest Distributor of Metal/Radiation Detection Wands in United States
6. Less than one month to opening of world’s largest global congress on osteoporosis
7. Small satellite takes on large thunderstorms
8. Pollution at home lurks unrecognized, instead attributed to large-scale environmental disasters
9. Researchers solve piece of large-scale gene silencing mystery
10. Tips for making a green holiday from the worlds largest scientific society
11. Large DNA stretches, not single genes, shut off as cells mature
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/11/2014)... Minn. , Dec. 10, 2014  Data ... physiologic monitoring, has released a new series of ... of preclinical toxicology researchers. M series, part of ... toxicologists collect the best possible physiologic data when ... Adding functional endpoints to toxicology studies has ...
(Date:12/10/2014)... , Dec. 08, 2014 Research and Markets ... addition of the "Biometrics Market in Japan ... http://photos.prnewswire.com/prnh/20130307/600769 The ... such as rural banking and upgradation of the ... witnessed in the market. Besides the aforementioned projects, ...
(Date:12/3/2014)... , Dec. 2, 2014   Marvin ... deployed, innovative test solutions for military, aerospace, and ... version of its successful TS-900 PXI semiconductor ... and features of high-end systems to customers at ... value compared to traditional ATE. ...
Breaking Biology News(10 mins):New telemetry implants expected to change how large animal toxicology studies are conducted 2Biometrics Market in Japan 2014-2018: Key Vendors are DDS, Fujitsu, Hitachi and NEC 2Marvin Test Solutions Brings New Capabilities to PXI-Based Semiconductor Test with TS-960 2Marvin Test Solutions Brings New Capabilities to PXI-Based Semiconductor Test with TS-960 3
... proteins of human cells infected with a common cold virus ... the genetic information we hold on animals by around 70 ... Methods , could revolutionise our understanding of animal genetics and ... SARS that jump the species barrier from animals to humans. ...
... nuclear magnetic resonance (NMR) technology is capable of detecting ... of blood. Microvesicles shed by cancer cells are even ... detecting them could prove a simple means for diagnosing ... , investigators at the Massachusetts General Hospital (MGH) Center ...
... Nobody knows the remarkable properties of human skin like ... our skin sensitive, sending the brain precise information about ... preserve a protective barrier against the world. Combining these ... exciting challenge for Stanford Chemical Engineering Professor Zhenan Bao ...
Cached Biology News:Scientists discover new method of gene identification 2Detection, analysis of 'cell dust' may allow diagnosis, monitoring of brain cancer 2Detection, analysis of 'cell dust' may allow diagnosis, monitoring of brain cancer 3Touch-sensitive plastic skin heals itself 2Touch-sensitive plastic skin heals itself 3
(Date:12/22/2014)... , Dec. 22, 2014  Alternative Energy ... that it has signed a letter of intent ... has developed and patented a nanotechnology-based development platform ... products that enable rapid on-site collection and testing ... and health issues in an immediate, non-invasive and ...
(Date:12/22/2014)... 2014 The American Journal ... original research, reviews and editorials addressing developments and ... today published a provocative article exploring the role ... and potential treatment of prostate cancer. , ... proposes the possibility that there could be a ...
(Date:12/19/2014)... PA (PRWEB) December 19, 2014 ... leading developer and manufacturer of needle-free injection technology, ... agreement with Immunomic Therapeutics, Inc. (“ITI”) for ITI ... device with its LAMP™ vaccine platform. , ... an exclusive Worldwide license to the Biojector®-2000 that ...
(Date:12/19/2014)... 2014 Naurex Inc., a biopharmaceutical company leveraging ... of the central nervous system, today announced that ... will present at the 33 rd annual J.P. ... at 3:00 p.m. PST on Tuesday, January 13, 2015, ... Francisco, Calif. About Naurex ...
Breaking Biology Technology:ALNE Announces Intention To Acquire BioTechPharma 2Prostate Cancer Experts Dissect the Role of Follicle-stimulating Hormone in the Development, Progression and Potential Treatment of Prostate Cancer 2Prostate Cancer Experts Dissect the Role of Follicle-stimulating Hormone in the Development, Progression and Potential Treatment of Prostate Cancer 3Prostate Cancer Experts Dissect the Role of Follicle-stimulating Hormone in the Development, Progression and Potential Treatment of Prostate Cancer 4Bioject and Immunomic Therapeutics Enter into an Agreement for License of Needle-Free Technology for LAMP-vax Vaccines 2Bioject and Immunomic Therapeutics Enter into an Agreement for License of Needle-Free Technology for LAMP-vax Vaccines 3Naurex to Present at 33rd Annual J.P. Morgan Healthcare Conference 2
... Serial Analysis of Gene ... differentially expressed genes by comparative analyses. SAGE is a powerful ... analysis of large numbers of cellular transcripts, leading to a ... accurate quantitative analysis of the relative levels of genes expressed ...
... Purpose , ... note in this series describes an LC/MS/MS method for the ... (TAC, aka FK-506), Sirolimus (SIR, aka Rapamycin) and Everolimus (EVE, ... simple and robust hardware configuration and shows to be fast ...
... , , ... As the study of protein biomarkers ... based on protein pathway information and discovery-based proteomics experiments. Even larger ... on microarray-based gene expression studies or other genomic information. , ...
Cached Biology Technology:Serial Analysis of Gene Expression Using ABI PRISM DNA Sequencers and BigDye Terminators 2Serial Analysis of Gene Expression Using ABI PRISM DNA Sequencers and BigDye Terminators 3Serial Analysis of Gene Expression Using ABI PRISM DNA Sequencers and BigDye Terminators 4Serial Analysis of Gene Expression Using ABI PRISM DNA Sequencers and BigDye Terminators 5A new LC/MS/MS Research Method for Rapid Quantitation of Five Immunosuppressant Drugs, including Mycophenolic Acid (MPA) 2A new LC/MS/MS Research Method for Rapid Quantitation of Five Immunosuppressant Drugs, including Mycophenolic Acid (MPA) 3A new LC/MS/MS Research Method for Rapid Quantitation of Five Immunosuppressant Drugs, including Mycophenolic Acid (MPA) 4A new LC/MS/MS Research Method for Rapid Quantitation of Five Immunosuppressant Drugs, including Mycophenolic Acid (MPA) 5Multiplexed Quantitative Peptide Assays for Protein Biomarkers of Cardiovascular Disease in Human Plasma 2Multiplexed Quantitative Peptide Assays for Protein Biomarkers of Cardiovascular Disease in Human Plasma 3Multiplexed Quantitative Peptide Assays for Protein Biomarkers of Cardiovascular Disease in Human Plasma 4Multiplexed Quantitative Peptide Assays for Protein Biomarkers of Cardiovascular Disease in Human Plasma 5
Agarose II (Low Melt)...
... antibody raised against a partial recombinant FES. ... 120 a.a. ~ 250 a.a) partial recombinant ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Accession Number: AAH35357 ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
Biology Products: