Navigation Links
La Jolla Institute scientist leads team which discovers important new player in diabetes onset
Date:6/7/2010

Ph.D., from the University of Virginia, was lead author on the paper and Dr. Hedrick, who was a faculty member at the University of Virginia before joining the La Jolla Institute in late 2009, was senior author.

Ann Marie Schmidt, Ph.D., the Gerald & Janet Carrus Professor of Surgical Science at Columbia University, who specializes in research on the mechanisms of diabetic complications, called the finding a "very novel and extremely important" discovery illuminating the ABCG1 protein's role in optimizing insulin secretion. "This mechanism may be very helpful for people with type 2 diabetes, but also type 1 because it may extend the period of time before all insulin-producing potential is gone," she said. "While delaying disease onset is important in both types of diabetes, it is particularly critical for type 1 diabetics who tend to manifest diabetes as children and who can suffer more severe disease consequences because of the lifelong nature of their illness and their eventual complete loss of the ability to produce insulin."

Matthias von Herrath, M.D., director of the La Jolla Institute's Type 1 Diabetes Research Center, agreed and praised the ABCG1 finding as an important step in understanding the cellular mechanisms of insulin secretion. "Dr. Hedrick's discovery offers important insights on possible ways to increase insulin production, which is key to controlling both types of diabetes," said Dr. von Herrath, who is among the world's leading type 1 diabetes researchers. "We are pleased that she recently joined our Institute and will be contributing to our Center's efforts to combat this terrible disease."

Dr. Hedrick, who primarily researches the high correlation between diabetes and heart disease, began studying the ABCG1 protein several years ago as she looked at cholesterol buildup and coronary plaque formation in diabetes sufferers. "The primary, known function of ABCG1 is to remove excess cholesterol from the body. But wi
'/>"/>

Contact: Bonnie Ward
contact@liai.org
619-303-3160
La Jolla Institute for Allergy and Immunology
Source:Eurekalert

0

GOOD

Page: 1 2 3 4

Related biology news :

1. Visionary concept earns La Jolla Institute scientist prestigious NIH Pioneer Award
2. La Jolla Institute discovers novel tumor suppressor
3. La Jolla Institute signs exclusive license agreement with Medimmune on major asthma discovery
4. Harvards Wyss Institute uses natures design principles to create specialized nanofabrics
5. Rensselaer Polytechnic Institute professor Patrick Underhill receives NSF CAREER award
6. NOAA selects University of Miami to lead major southeastern US cooperative institute
7. Oklahoma Blood Institute to Leverage BIO-key(R) Breakthrough TruDonor(TM) Fingerprint Donor Identification
8. Rensselaer Polytechnic Institute wins $2.45 million grant to support stem cell research
9. Allen Institute for Brain Science launches Allen Human Brain Atlas
10. NYU Cancer Institute experts present at American Society of Clinical Oncology annual meeting
11. UM receives 5th consecutive Howard Hughes Medical Institute grant for science education
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/19/2013)... Course at the Marine Biological Laboratory (MBL), Woods ... Microbiology site by the American Society for Microbiology ... recognizes institutions and the scientists who worked there ... science of microbiology. A ceremony unveiling the ... for Saturday, June 22, 2013, at 4:30 pm ...
(Date:6/19/2013)... University of Pittsburgh has developed antibacterial compounds, derived ... be potential treatments for drug-resistant bacterial infections and ... are quite small, making them inexpensive and easy ... June 2013 issue of the journal Antimicrobial ... many probable applications will likely be the chronic ...
(Date:6/19/2013)... June 19, 2013 A decade-long JDRF-funded study ... Helmholtz Zentrum Mnchen, Germany, is providing a deeper ... risk of developing type 1 diabetes (T1D), highlighting ... for the disease. The study, "Seroconversion to Multiple ... in Children," was published today in The ...
Breaking Biology News(10 mins):Microbial diversity course designated as a 'Milestones in Microbiology' site 2HIV-derived antibacterial shows promise against drug-resistant bacteria 2New data on islet autoantibodies in young children defines early type 1 diabetes development 2
... that the loss of a gene called p63 accelerates aging ... many organisms, including humans. Therefore, the p63 gene is likely ... "To study how the p63 gene works, we devised a ... us right away was that these p63 deficient mice were ...
... study has followed a single humpback whale from one ... the migratory patterns of these majestic marine mammals in ... Society (WCS), the American Museum of Natural History (AMNH), ... Society's Biology Letters, a male humpback whale that was ...
... the introduction of the varicella (chicken pox) vaccine in ... have dropped dramatically, according to a study in the ... recommended for routine immunization of children aged 12 to ... in the United States, according to background information in ...
Cached Biology News:Gene loss accelerates aging 2Genetics links whale to two different ocean basins 2Hospitalizations because of chicken pox down dramatically since implementation of vaccine 2Hospitalizations because of chicken pox down dramatically since implementation of vaccine 3
(Date:6/19/2013)... , June 19, 2013 ... ) has announced the addition of the ... Opportunities, 2018" report to their offering. ... Lack of data protection and old ... PIN codes have driven the growth of ...
(Date:6/19/2013)... -- Continuing its long history of proven clinical performance in ... Inc. announces the U.S. Food and Drug Administration (FDA) ... assay for use on its Access 2 immunoassay system. ... Coulter,s troponin I test for over 12 years ... to continue providing dependability to laboratories supporting emergency care," ...
(Date:6/19/2013)... 2013 Biotechnology industry pioneer Amgen (NASDAQ: ... provider BlackLine Systems  and enterprise application software leader ... a webinar next week entitled "No Account Left Behind!  ... SAP to Help Keep Its Account Reconciliations in Good Shape ... The webinar, geared at finance, accounting, audit and ...
(Date:6/19/2013)... (PRWEB) June 19, 2013 Applied Rigaku ... report that details the measurement of sulfur in ultra-low ... QC+ high resolution benchtop EDXRF analyzer . The analysis ... test method ISO 13032. This International Standard specifies ... the determination of sulfur content in automotive gasoline. , ...
Breaking Biology Technology:Global Biometric Systems Market Forecast Report - Opportunities to 2018 2Global Biometric Systems Market Forecast Report - Opportunities to 2018 3Beckman Coulter Announces FDA Clearance of New Access AccuTnI+3 Troponin I Assay for the Access 2 Immunoassay System 2Beckman Coulter Announces FDA Clearance of New Access AccuTnI+3 Troponin I Assay for the Access 2 Immunoassay System 3Amgen Joins BlackLine Systems, SAP for Webinar on Automating Account Reconciliations 2Amgen Joins BlackLine Systems, SAP for Webinar on Automating Account Reconciliations 3Amgen Joins BlackLine Systems, SAP for Webinar on Automating Account Reconciliations 4Rigaku Publishes New Application Note for Analysis of ULSD Per ISO 13032 2
... Calif., May 8 Edwards Lifesciences,Corporation (NYSE: EW ... valves,announced that the company will celebrate a number of ... meeting of the American,Association for Thoracic Surgery (AATS), May ... by Edwards -- which this year celebrates,its 50th anniversary ...
... ALTO, Calif., May 8 Telik, Inc. (Nasdaq:,TELK) today ... per share, for,the first quarter ended March 31, 2008, ... per share, for the comparable period in 2007., ... costs and,expenses were $10.6 million, compared with $18.0 million ...
... Md., May 8 The Maryland Stem Cell,Research ... 122,applications in response to its three official Requests ... Maryland Technology Development,Corporation (TEDCO) reviewed the Commission,s recommendations ... Maryland Stem Cell Research,Fund (MSCRF) under the Maryland ...
Cached Biology Technology:Edwards Lifesciences Celebrates One Million Heart Valve Patients and More at AATS 2008 2Edwards Lifesciences Celebrates One Million Heart Valve Patients and More at AATS 2008 3Edwards Lifesciences Celebrates One Million Heart Valve Patients and More at AATS 2008 4Telik Announces First Quarter 2008 Financial Results 2Telik Announces First Quarter 2008 Financial Results 3Maryland Stem Cell Research Commission Recommends 62 Projects for Funding 2Maryland Stem Cell Research Commission Recommends 62 Projects for Funding 3
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products: