Navigation Links
Kids now see fewer television ads for sweets and beverages, but more for fast food
Date:7/5/2010

Children saw fewer television advertisements for certain foods, including those for sweets and beverages, in 2007 compared with 2003, according to a report posted online today that will appear in the September print issue of Archives of Pediatrics & Adolescent Medicine, one of the JAMA/Archives journals. However, children now see more fast-food ads, and racial gaps in exposure to all food advertising have increased.

An Institute of Medicine (IOM) report concluded that there was strong evidence that television advertising influences the short-term eating habits of children age 2 to 11, and moderate evidence that advertising influences their usual dietary intake, according to background information in the article. In 2006, 10 major U.S. food companies pledged to devote at least half of their child-targeted advertising to healthier products or encouraging good nutrition and healthy lifestyles, an effort called the Children's Food and Beverage Advertising Initiative. By 2009, 16 companies had signed on. "Given that each company defined their own better-for-you products and also had different definitions of what constituted children's programming, key questions remain," the authors write.

To assess trends in food advertising before and after the initiative, Lisa M. Powell, Ph.D., and colleagues at the University of Illinois at Chicago studied television ratings data from Nielsen Media Research for the calendar years 2003, 2005 and 2007.

Between 2003 and 2007, daily average exposure to televised food ads decreased by 13.7 percent among children age 2 to 5 and 3.7 percent among children age 6 to 11, but increased by 3.7 percent among teens age 12 to 17. Ads for sweets became less frequent, with a 41 percent decrease in exposure for 2- to 5-year-olds, 29.3 percent for 6- to 11-year-olds and 12.1 percent for 12- to 17-year-olds. Beverage ads also decreased in frequency, by about 27 percent to 30 percent across age groups, with substanti
'/>"/>

Contact: Sherri McGinnis Gonzalez
smcginn@uic.edu
312-996-8277
JAMA and Archives Journals
Source:Eurekalert

Page: 1 2

Related biology news :

1. Fragmented forests result in more snakes, fewer birds
2. Fewer honey bee colonies and beekeepers throughout Europe
3. Even small dietary reductions in salt could mean fewer heart attacks, strokes and deaths
4. Moa get fewer: Landmark study
5. The EU must allocate fewer emission allowances and stop making free allocations
6. New MRI technique could mean fewer breast biopsies in high-risk women
7. Fewer deaths with preventive antibiotic use
8. Fewer babies born after Caesarean delivery
9. Warmer springs mean less snow, fewer flowers in the Rockies
10. CBS and OMD Partner to Provide the Agency With Access to the Networks Television City Research Facility in Las Vegas
11. Television has less effect on education about climate change than other forms of media
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/25/2015)... , June 25, 2015  Imagine a tool ... toward a healthier, happier life. That,s exactly what USANA,s ... to do. The cutting-edge, portable health program provides a ... solutions to help improve your lifestyle and nutrition. ... dinner and gala Wednesday night, USANA,s THA was honored ...
(Date:6/24/2015)... Research and Markets( ... "Huawei Ascend Mate 7 Fingerprint Sensor - ... Huawei,s technological choice for the fingerprint ... Apple,s and Samsung,s one. The Ascend Mate 7 ... Cards, a main actor in capacitive sensing human ...
(Date:6/23/2015)... June 23, 2015  Crossmatch™, a leading ... today announced enhanced functionality of its DigitalPersona ... The enhancements build on the native flexibility ... Altus platform and provide expanded mobile credential ... In today,s environment of increasing cyber-attacks and ...
Breaking Biology News(10 mins):@USANAinc's Personalized Nutrition Program Wins Industry Innovation Award 2Huawei Ascend Mate 7 Fingerprint Sensor - Reverse Costing Analysis 2Crossmatch Releases Enhanced DigitalPersona Altus Advanced Authentication Functionality 2
... vision has been inspiring debate across the scientific community ... to the wider discussion about open access publishing has ... publication of its first few articles (please see ... issued and further articles will be published on the ...
... but few studies of lung nodule identification and clinical ... Kaiser Permanente Southern California identified 7,112 patients who had ... the electronic medical record. Their study presented ... for the Study of Lung Cancer,s (IASLC) Journal ...
... notorious for secreting chemicals that confuse the immune system ... some cancer treatments try to neutralize the cancer,s chemical ... do both at the same time are rarely successful. ... simultaneously deliver a sustained dose of both an immune-system ...
Cached Biology News:First articles now live on F1000 Research 2First articles now live on F1000 Research 3Elegant delivery 2Elegant delivery 3
(Date:7/2/2015)... 2, 2015  Spherix Incorporated (Nasdaq: SPEX ) -- an ... monetization of intellectual property, today announced a litigation update. ... v. Verizon Services Corp. et al. , Case No. ... Eastern District of Virginia , the ... interpreting certain key claims in favor of the Defendants ...
(Date:7/1/2015)... ... July 01, 2015 , ... It is now possible ... using single photon emission computed tomography (SPECT) according to researchers from Amen ... examined over 20,000 brain scans and is believed to be the largest brain imaging ...
(Date:7/1/2015)... AURORA, Colo. and BANGALORE, India ... a global genomic profiling company that uses next generation ... appointment of Scott A. Storrer as chief ... and CEO, he will be responsible for all strategy, ... Vijay Chandru , who has served as Strand,s chairman ...
(Date:7/1/2015)... ... July 01, 2015 , ... A newly launched business plan contest ... the barriers to innovation in life sciences R&D. The Pistoia Alliance President’s Startup Challenge ... of US$15,000 and a period of expert mentorship from a senior industry figure drawn ...
Breaking Biology Technology:Spherix Issues A Litigation Update 2Spherix Issues A Litigation Update 3Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 2Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 3Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 4Strand Life Sciences Names Scott A. Storrer CEO as Company Continues Global Expansion with Focus on Precision Medicine Product 2Strand Life Sciences Names Scott A. Storrer CEO as Company Continues Global Expansion with Focus on Precision Medicine Product 3Pistoia Alliance Launches Startup Challenge 2Pistoia Alliance Launches Startup Challenge 3
... -- N. BILLERICA, Mass., Sept. 20 ... ... ... are keyed by longUrl, so we need to grab the first one. for (var r in data.results) ...
... Mass., Sept. 20 Caliper Life Sciences, Inc. (Nasdaq: ... President and CEO of Caliper will be providing a ... Basel, Switzerland. This invited presentation, entitled "Next Generation Tools ... and will highlight key trends that are transforming "sick ...
... (NYSE Amex: NBS ) ("NeoStem" or the "Company"), ... China, announced today that its CEO, Dr. Robin Smith, is ... the FOX Business Network.   The show,s first ... will air each upcoming Saturday at 1:30 p.m. Eastern Time ...
Cached Biology Technology:Seahorse Bioscience to Present at 2010 UBS Global Life Sciences Conference 2Seahorse Bioscience to Present at 2010 UBS Global Life Sciences Conference 3Seahorse Bioscience to Present at 2010 UBS Global Life Sciences Conference 4Seahorse Bioscience to Present at 2010 UBS Global Life Sciences Conference 5Seahorse Bioscience to Present at 2010 UBS Global Life Sciences Conference 6Caliper Life Sciences CEO to Present Keynote Presentation at MipTec European Conference 2FOX Business Network Airing In-Depth Look at NeoStem 2FOX Business Network Airing In-Depth Look at NeoStem 3
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
... antibody raised against a partial ... Immunogen: PPP4C (NP_002711, 218 ... recombinant protein with GST tag. ... NM_002720 ...
Biology Products: