Navigation Links
It's a unisex brain with specific signals that trigger 'male' behavior
Date:4/30/2008

New Haven, Conn. Research by Yale scientists shows that males and females have essentially unisex brains at least in flies according to a recent report in Cell designed to identify factors that are responsible for sex differences in behavior.

The researchers showed that a courting song and dance routine that only male flies naturally perform one wing is lifted and wiggled to make a humming song can also be triggered in female flies by artificially stimulating particular brain cells that are present in both sexes. It isnt what youve got its how you use it, the authors say.

It appears there is a largely bisexual or unisex brain. Anatomically, the differences are subtle and a few critical switches make the difference between male and female behavior, said senior author Gero Miesenboeck, formerly of Yale University and now at the University of Oxford.

According to the authors, most male animals have to perform elaborate courtship displays to try to convince the female that they are worthy mates. Their study was designed to see what neurons were responsible for behavior in the courtship dance of flies, and how the neural circuits in males and females differed. To do this, they genetically engineered specific neurons in the fly to respond to light. This optical trick allowed them to activate the neural circuits that control the behavior pattern directly.

Using a flash of laser light as a remote control for the brain cells, the researchers first identified which nerve cells control the courting behavior in males. Next, they showed that the cells were present and functional in both males and females, even though only males do the song and dance.

Surprisingly, when the brain cells of female flies were flashed with the laser cue we found that even the female flies that never normally behaved this way, began to sing, said Dylan Clyne, a Yale post-doctoral associate and primary investigator of the study. Our work shows
'/>"/>

Contact: Janet Rettig Emanuel
janet.emanuel@yale.edu
203-432-2157
Yale University
Source:Eurekalert  

Page: 1 2

Related biology news :

1. Detecting dangerous chemicals with lasers, exploring the brains circuitry with light and more
2. Vitamin D in brain function
3. Unconscious decisions in the brain
4. Brain study may lead to improved epilepsy treatments
5. Learning and the brain
6. Can micro-scaffolding help stem cells rebuild the brain after stroke?
7. Scientists ask whether microscaffolding can help stem cells rebuild brain after stroke damage
8. Your babys brain on drugs (and alcohol and tobacco)
9. Autism Speaks collaborates on grant with the Allen Institute for Brain Science and autism expert
10. Veterinary college researcher studying brain tumors in people and animals
11. Harvard researchers publish MRI images of genes in action in the living brain
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
It's a unisex brain with specific signals that trigger 'male' behavior
(Date:12/11/2014)... 2014  Data Sciences International (DSI), the global ... new series of digital telemetry implants to meet ... series, part of the PhysioTel™ Digital platform, was ... physiologic data when incorporating functional endpoints into repeat-dose ... toxicology studies has evolved from short ECG strips ...
(Date:12/10/2014)... DIEGO , Dec. 9, 2014 CIE ... collaboration catalyst that provides the connective tissue that enhances ... enabling them to easily share client-level information; earned a ... to expand to organizations serving seniors aging in community ... Diego" partner on December 11 th 4-6p. ...
(Date:12/5/2014)... , Dec. 4, 2014  Tute Genomics, a leader ... million in Series A1 funding led by UK-based Eurovestech. ... participated in the investment round. "We are ... community adopts next-generation sequencing and seeks new approaches for ... Reid Robison , MD MBA, and CEO of Tute ...
Breaking Biology News(10 mins):New telemetry implants expected to change how large animal toxicology studies are conducted 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 2Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 3Community Information Exchange San Diego Launches Pilot, Secures $1 Million Expansion Grant, and Becomes a "Live Well San Diego" Partner 4Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 2Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 3
... You don,t need to spray weedkiller to remove the ... with either boiling water, steam or flaming will dispatch even ... a new PhD project from the University of Copenhagen. ... is important that each treatment is dosed correctly. Basically, ...
... Johns Hopkins scientists have engineered cells that behave like ... on one or more unique inputs. This feat, published in ... eventually help researchers create computers that use cells as tiny ... in the Department of Cell Biology and member of the ...
... BETHESDA, MD May 30, 2012 The Genetics Society ... six graduate students and seven postdoctoral researchers as recipients of ... Each of these early-career geneticists receives a $1,000 travel award ... in a laboratory course of their choice that will enhance ...
Cached Biology News:Blanch your weeds 2Training cells to perform Boolean functions? It's logical 2Training cells to perform Boolean functions? It's logical 3The Genetics Society of America announces DeLill Nasser Travel Award recipients 2
(Date:12/19/2014)... Dec. 18, 2014 Egenix, Inc. is pleased to ... Chairman of the Board, to succeed Donald Fresne ; ... will continue as a member of the Board.  In recognition ... to the company over almost twenty years, the Board designated ... of Directors has established a Search Committee to find a ...
(Date:12/17/2014)... 2014 The Activated Carbon Manufacturing ... is why IBISWorld updated its original industry research report. ... from an intensified focus on environmental policy. Over the ... standards for power plants and a range of other ... Industry Analyst Sarah Kahn, “a range of downstream industrial ...
(Date:12/17/2014)... 17, 2014 Achim Noack has been ... Stoller Group. In this position, Noack will assist Jerry ... matters, develop marketing strategy and supervise global marketing management ... “Achim has tremendous knowledge and experience in the crop ... “His experience and innovative thinking will be a great ...
(Date:12/17/2014)... Dallas, Texas (PRWEB) December 17, 2014 ... research on Global Quartz Tubing industry. For an ... information, definition, classification, application, industry chain structure, industry ... domestic quartz tubing industry has witnessed ... through a number of acquisitions. This report mentions ...
Breaking Biology Technology:Activated Carbon Manufacturing in the US Industry Market Research Report Has Been Updated from IBISWorld 2Activated Carbon Manufacturing in the US Industry Market Research Report Has Been Updated from IBISWorld 3Achim Noack Joins Stoller Group as Global Vice President of Marketing and Administration 22020 Quartz Tubing Market: Global Development & Forecasts Analysis Now at DeepResearchReports.com 2
... BioMed Realty Trust, Inc. (NYSE: BMR ), a real ... Science Industry®, today announced financial results for the third quarter ended ... Generated record total revenues for the third quarter of ... in 2009. Increased rental revenues for the third quarter by ...
... to develop relatively advanced tools after their brains evolved a ... that investigates why it took early humans almost two million ... axe. Researchers used computer modelling and tiny sensors embedded ... humans needed in order to make two types of tools ...
... New Mexico, NOVEMBER 3, 2010Scientists at the U.S. Department ... Laboratory have fabricated transparent thin films capable of absorbing ... area. The material, described in the journal Chemistry ... transparent solar panels. "Potentially, with future refinement of ...
Cached Biology Technology:BioMed Realty Trust Reports Third Quarter 2010 Financial Results 2BioMed Realty Trust Reports Third Quarter 2010 Financial Results 3BioMed Realty Trust Reports Third Quarter 2010 Financial Results 4BioMed Realty Trust Reports Third Quarter 2010 Financial Results 5BioMed Realty Trust Reports Third Quarter 2010 Financial Results 6BioMed Realty Trust Reports Third Quarter 2010 Financial Results 7BioMed Realty Trust Reports Third Quarter 2010 Financial Results 8BioMed Realty Trust Reports Third Quarter 2010 Financial Results 9BioMed Realty Trust Reports Third Quarter 2010 Financial Results 10BioMed Realty Trust Reports Third Quarter 2010 Financial Results 11BioMed Realty Trust Reports Third Quarter 2010 Financial Results 12BioMed Realty Trust Reports Third Quarter 2010 Financial Results 13BioMed Realty Trust Reports Third Quarter 2010 Financial Results 14BioMed Realty Trust Reports Third Quarter 2010 Financial Results 15BioMed Realty Trust Reports Third Quarter 2010 Financial Results 16BioMed Realty Trust Reports Third Quarter 2010 Financial Results 17Stone Age humans needed more brain power to make big leap in tool design 2Scientists produce transparent, light-harvesting material 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... kit contains sufficient materials for 1,464 array sample elements. ... 4 each , Blocker BSA in PBS (10X): ... , BupH Phosphate Buffered Saline: 8 packs ... SuperSignal West Pico Luminol Enhancer: 2 x 25 ml ...
Biology Products: