Navigation Links
Innovations in Pediatric Medicine International Conference brings together pediatrics experts
Date:11/7/2008

NEW YORK (Nov. 6, 2008) -- On Nov. 8 and 9, Morgan Stanley Children's Hospital of NewYork-Presbyterian and Columbia University Medical Center will host an "Innovations in Pediatric Medicine" conference at the Grand Hyatt New York, which will feature lectures by international leading authorities in pediatric biomedical research, genetic findings and stem cell therapy breakthroughs.

Key topics include discoveries about congenital and primary immunodeficiencies; gene therapy in children; and the genetic basis for common childhood infections. In addition, there will be a unique presentation on pediatric emergency care during disasters and the lessons learned from Hurricane Marilyn on St. Thomas; the 2001 attack on the World Trade Center in New York; the 2003 earthquake in Bam, Iran; and Hurricane Katrina.

"Medical breakthroughs have greatly increased the range of treatment options for pediatric diseases, making it vital to bring together medical professionals who are on the frontline of pediatric care for this opportunity to learn the latest progress and to share best practices," says the conference's course director, Dr. Mitchell Cairo, director of pediatric blood and marrow transplantation at Morgan Stanley Children's Hospital of NewYork-Presbyterian and professor of pediatrics, medicine and pathology at Columbia University College of Physicians and Surgeons.

Listed below are some key presentations by leaders in their field:

  • Dr. Alain Fischer of Descartes University Hospital NeckerEnfants Malades, Paris, France, will discuss gene therapy for inherited disorders based on research on the treatment of severe combined immunodeficiency. Introducing genes into bone marrow stem cells led to sustained correction of the disease for almost 10 years, providing evidence that the approach can be effective and could be used to treat other genetic diseases of blood cells. One challenge is the viral vector used to introduce the g
    '/>"/>

Contact: Belinda Mager
bem9048@nyp.org
212-305-5587
New York- Presbyterian Hospital/Columbia University Medical Center
Source:Eurekalert

Page: 1 2

Related biology news :

1. Innovations in Pediatric Medicine CME conference brings together national pediatrics experts
2. Improving industry efficiency through environmental innovations
3. New chemical radar among national security innovations in ACS podcast
4. Sonic Innovations Celebrates 10-Year Anniversary
5. Synaptics SecurePad(TM) Selected as CES Innovations 2008 Design and Engineering Award Honoree
6. OHSU turns innovations into commercial opportunities at record pace
7. Immune system protein accurate predictor of survival in pediatric septic shock
8. Immunotherapy in high-risk pediatric sarcomas shows promising response
9. Pediatricians alerted to the developmental nature of underage drinking in special journal supplement
10. Leading pediatrician addresses the future of childrens health
11. Researchers at UH explore patient preferences for personalized medicine
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/10/2014)... NEW YORK , Dec. 8, 2014 You,ve ... online banking account but can,t remember your password, site key ... birthday? Who was your first grade teacher? ... launches the app that will finally put an ... PINs – 1U TM . 1U leverages a ...
(Date:12/10/2014)... Forest Baptist Medical Center today announced plans for a ... Funding for this $50 million capital project is part ... launched next summer. The medical education ... R.J. Reynolds Tobacco Company complex, adjacent to 525@vine in ... plans to be ready to welcome medical students in ...
(Date:12/10/2014)... , Dec. 08, 2014 Research and Markets ... addition of the "Biometrics Market in Japan ... http://photos.prnewswire.com/prnh/20130307/600769 The ... such as rural banking and upgradation of the ... witnessed in the market. Besides the aforementioned projects, ...
Breaking Biology News(10 mins):The Password is Finally Dead: Launch of 1U Mobile App Eliminates Need for All Usernames and Passwords 2The Password is Finally Dead: Launch of 1U Mobile App Eliminates Need for All Usernames and Passwords 3Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 2Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 3Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 4Biometrics Market in Japan 2014-2018: Key Vendors are DDS, Fujitsu, Hitachi and NEC 2
... 28, 2008) Just three years after it was discovered, ... to the Wildlife Conservation Society, which recently published the first-ever ... "kipunji," the large, forest-dwelling primate hovers at 1,117 individuals, according ... journal Oryx . The population estimate was ...
... at Houston say they are the first to provide ... may be an autoimmune disease. Their research could provide ... Findings appear online in Nature Medicine on ... Xia, M.D., Ph.D., an assistant professor of biochemistry and ...
... to dangerously low levels in diseases such as anemia ... cells, doctors filter platelets from donated blood, but this ... and cause other side effects in patients who need ... have been trying to generate platelets from embryonic stem ...
Cached Biology News:Pre-eclampsia may be autoimmune disease 2Pre-eclampsia may be autoimmune disease 3
(Date:12/24/2014)... “Preparative & Process Chromatography Market by Instrument ... Buffers, Valves, Guages, Seals), Accessories, Services, End User ... 2019” provides a detailed overview of the major ... strategies impacting the preparative and process chromatography market ... revenue and share analysis. , Full Copy ...
(Date:12/24/2014)... Island, New York (PRWEB) December 23, 2014 ... and the Long Island Affiliate of ITRA Global, the national ... slow but steady recovery. This is evidenced by the ... the strong stock market. Low energy costs have held ... The only negative is the housing market remaining soft. ...
(Date:12/24/2014)... , Dec. 23, 2014 China ... the "Company"), a leading fully integrated plasma-based biopharmaceutical ... announced that its majority-owned subsidiary, Shandong Taibang Biological ... ("GMP") certification from the China Food and Drug ... production facility. As previously disclosed in the Company,s ...
(Date:12/24/2014)... PARIS and NEW YORK ... data from its open-label pilot study of mazindol in ... Design, Development and Therapy in December 2014 . ... of mazindol in children with attention deficit/hyperactivity disorder" ( ... 2014 Dec 1;8:2321-2332. eCollection 2014 ) ...
Breaking Biology Technology:Preparative and Process Chromatography Market is expected to reach $9 billion by 2019 - New Report by Marketsandmarkets 2Preparative and Process Chromatography Market is expected to reach $9 billion by 2019 - New Report by Marketsandmarkets 3Preparative and Process Chromatography Market is expected to reach $9 billion by 2019 - New Report by Marketsandmarkets 4ITRA Global Reports Long Island Is Out of Sync With The National Office Market 2ITRA Global Reports Long Island Is Out of Sync With The National Office Market 3China Biologic Receives GMP Certification for New Coagulation Factor Facility 2China Biologic Receives GMP Certification for New Coagulation Factor Facility 3Redefining ADHD: A New Approach & A Shift of Paradigm in ADHD Therapeutics 2Redefining ADHD: A New Approach & A Shift of Paradigm in ADHD Therapeutics 3
... Polytechnic Institute Professor James Jian-Qiang Lu was recognized ... toward the design and realization of 3-D integrated ... Department of Electrical, Computer, and Systems Engineering (ECSE) ... D. Ashman Achievement Award for 2010 from the ...
... Intarcia Therapeutics. Inc today announced that Kurt ... presenting at the Lazard Capital Markets 7th Annual ... Tuesday, November 16, 2010 at 1:40pm local time ... (Logo:   http://photos.prnewswire.com/prnh/20050301/SFTU126LOGO ) ...
... 11, 2010 StemCyte, Inc., one of the world,s ... is proud to announce that the Company has been ... Internal Revenue Service,s Qualifying Therapeutic Discovery Project (QTDP) program ... than 250 employees. The Patient Protection and ...
Cached Biology Technology:Rensselaer Polytechnic Institute professor James Lu garners award for research on 3-D computer chips 2Intarcia Therapeutics Executive Chairman, Kurt Graves to Present at Lazard Capital Markets 7th Annual Healthcare Conference 2StemCyte Awarded $488,950 for Advanced Therapeutic Applications of Umbilical Cord Blood Stem Cells from the Qualifying Therapeutic Discovery Project (QTDP) 2
Agarose II (Low Melt)...
... antibody raised against a partial recombinant FES. ... 120 a.a. ~ 250 a.a) partial recombinant ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Accession Number: AAH35357 ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
Biology Products: