Navigation Links
Humans naturally cooperative, altruistic, social
Date:9/8/2011

ill health."

In addition to chapters co-authored by Sussman and Cloninger, the book includes articles by two other WUSTL faculty members Peter Benson, PhD, assistant professor of sociocultural anthropology, and Jane Phillips-Conroy, PhD, professor of anatomy and neurobiology and of anthropology and other academic experts from around the world.

Topics of the book's chapters which range from relationships among howler monkeys to the influences of modern Western culture on human spirituality were taken from discussions and presentations held at a 2009 conference at WUSTL titled "Man the Hunted: The Origin and Nature of Human Sociality, Altruism and Well-Being."

The conference, organized by Sussman and Cloninger, was the first of its kind to bring together international academics across disciplines to examine the evolution of cooperation, altruism and sociality in primates and humans.


'/>"/>

Contact: Jessica Daues
jessica_daues@wustl.edu
314-935-5230
Washington University in St. Louis
Source:Eurekalert

Page: 1 2

Related biology news :

1. Ancient humans were mixing it up
2. Competition with humans responsible for decline of New Zealands endangered sea lions, study shows
3. Competition with humans responsible for decline of New Zealands endangered sea lions, study shows
4. New UC sensor promises rapid detection of dangerous heavy metal levels in humans
5. Aging brains are different in humans and chimpanzees
6. Evidence for food addiction in humans
7. Can humans sense the Earths magnetism?
8. Plants teach humans a thing or two about fighting diseases
9. NYSCF-Robertson investigator at Stanford creates neurons directly from skin cells of humans
10. Monkey recall memory mirrors that of humans
11. 18th International Academy of Astronautics Humans in Space Symposium
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:1/22/2015)... OXFORD, Conn. , Jan. 20, 2015 NXT-ID, Inc. (NASDAQ: ... growing mobile commerce market, reports on the recent success of the Wocket™ ... Wocket smart wallet was named as one of the ... of the "5 Best Products Launched At CES So Far" by Newseveryday.com ...
(Date:1/22/2015)... MUNICH , January 22, 2015 ... its tenth year  The European Patent Office to present ... Two British nominations to be featured: Christofer Toumazou ... week featuring former finalists and winners of the Award   ...
(Date:1/22/2015)... 2015 Infinisource has launched its new NXG series of ... G2 sets a higher standard for collecting attendance and labor ... With plug-and-play installation, touch screen interface and seamless connection to ... time collection solution for the small to mid-size employer. ...
Breaking Biology News(10 mins):CES Response for NXT-ID's Wocket Smart Wallet Kicks Off 2015 2CES Response for NXT-ID's Wocket Smart Wallet Kicks Off 2015 3Ten Years of the European Inventor Award: A Retrospective Look at the Inventors and Ideas That Have Changed Our Lives 2Ten Years of the European Inventor Award: A Retrospective Look at the Inventors and Ideas That Have Changed Our Lives 3Infinisource's NXG series sets new time clock standard 2
... a female insect in order to attract males for pollination. ... Biology found that breeding two of these orchid species ... This new odour had no effect on normal solitary bees ... of wild bee that never visited any of the parent ...
... , Nerve cells communicate with each other by means ... cells exchange charged ions with their environment. However, the ... although some theories predicted a relation between the chloride ... Institute of Neurobiology in Martinsried were now able to ...
... A Georgetown University Medical Center research team has been ... Abuse to discover and develop new smoking cessation drugs ... Kenneth Kellar, PhD, a professor of pharmacology at GUMC ... $4.6 million. The theory, developed in Kellar,s lab ...
Cached Biology News:Chloride channels render nerve cells more excitable 2Chloride channels render nerve cells more excitable 3GUMC to develop smoking cessation aids based on unconventional nicotine addiction theory 2
(Date:1/22/2015)... , Jan. 22, 2015  Transwestern | RBJ today announces the ... office space for Shire a leading biopharmaceutical company, at Two ... | RBJ,s Robert Richards , president, and Brian ... for the entire five-floor building at 95 Hayden Ave. ...
(Date:1/22/2015)... January 21, 2015 Cambridge Semantics, the leading ... today announced that 2014 was a record-breaking year across the ... of the Anzo Smart Data Platform and our Smart Data ... insights from diverse data which led to record growth for ...
(Date:1/22/2015)... January 22, 2015 Crystal Diagnostics (CDx) Xpress ... it has received AOAC-PTM Certifications for the six non-O157 Shiga ... O145; collectively referred to as STEC or the “Big-6”) as ... forming unit (cfu) per 325 g of raw ground beef ...
(Date:1/22/2015)... Dr. Greg Leyer of UAS Labs recently was ... Pre-Conference seminar on probiotics in San Diego, CA. , ... conference for health care professionals. This year’s pre-conference seminar was ... in health. Dr. Leyer spoke about the emerging topics and ...
Breaking Biology Technology:Transwestern | RBJ Advises Shire in 202,000 SF Lease, Creating Boston's Largest Suburban Biotech Campus 2Cambridge Semantics Announces Record Results for 2014 2Crystal Diagnostics Awarded AOAC-PTM Accreditation for the Rapid Detection of “Big 6” E.coli Food Pathogens 2
... Vaccine Induced Neutralizing Antibodies and Protected Mice upon ChallengeROCKVILLE, ... NVAX ) announced results from a preclinical study of ... the viral fusion (F) protein. The virus utilizes ... respiratory tract and cause illness. Novavax,s RSV-F ...
... Boston Scientific Corporation (NYSE: BSX ) ... ended December 31, 2008. Subsequent to the release ... a patent litigation settlement and, as expected, finalized a ... U.S. Generally Accepted Accounting Principles, these events are required ...
... 26 InterMune, Inc.,(Nasdaq: ITMN ) today announced ... December 31, 2008. InterMune reported a net loss for ... share, compared with a,net loss of $25.9 million, or $0.67 ... Dan Welch, Chairman, Chief Executive Officer and ...
Cached Biology Technology:NOVAVAX Announces Preclinical Study Results for a Respiratory Syncytial Virus ('RSV') Vaccine Candidate Directed Against the Fusion (F) Protein 2NOVAVAX Announces Preclinical Study Results for a Respiratory Syncytial Virus ('RSV') Vaccine Candidate Directed Against the Fusion (F) Protein 3NOVAVAX Announces Preclinical Study Results for a Respiratory Syncytial Virus ('RSV') Vaccine Candidate Directed Against the Fusion (F) Protein 4Boston Scientific Resolves Outstanding Litigation Matter, Finalizes Goodwill Impairment Charge 2Boston Scientific Resolves Outstanding Litigation Matter, Finalizes Goodwill Impairment Charge 3Boston Scientific Resolves Outstanding Litigation Matter, Finalizes Goodwill Impairment Charge 4Boston Scientific Resolves Outstanding Litigation Matter, Finalizes Goodwill Impairment Charge 5Boston Scientific Resolves Outstanding Litigation Matter, Finalizes Goodwill Impairment Charge 6Boston Scientific Resolves Outstanding Litigation Matter, Finalizes Goodwill Impairment Charge 7Boston Scientific Resolves Outstanding Litigation Matter, Finalizes Goodwill Impairment Charge 8Boston Scientific Resolves Outstanding Litigation Matter, Finalizes Goodwill Impairment Charge 9Boston Scientific Resolves Outstanding Litigation Matter, Finalizes Goodwill Impairment Charge 10InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 2InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 3InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 4InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 5InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 6InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 7InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 8InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 9InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 10InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 11InterMune Reports Fourth Quarter and Full Year 2008 Financial Results and Business Highlights 12
... for high-yield protein expression ,The ... a high-yielding clone of Sf9 cells. Pre-adapted ... Cell Medium, these cells are recommended for ... baculovirus infection or transfection of appropriate vectors. ...
... Mouse monoclonal antibody raised against a partial recombinant ... 358 a.a. ~ 457 a.a) partial recombinant protein ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Mouse monoclonal antibody raised against a partial recombinant QARS. NCBI Entrez Gene ID = QARS...
Biology Products: