Navigation Links
How New York City is preparing for climate change
Date:6/1/2010

nd retrofit ferries to use cleaner fuel. The new NPCC plan recognizes that these actions will not stop climate change alone and points to the climate risks already facing the city, such as heat waves, blackouts, flooding, and coastal storms.

In response to these challenges the NPCC calls for New York City to begin to adapt to climate change immediately and proposes the creation of flexible Adaptation Pathways, strategies that evolve through time as climate risk assessment, evaluation of adaptation strategies, and monitoring continue.

The report demonstrates how New York City has developed an effective approach to climate change adaptation by presenting the challenges of adaption as winwin opportunities for city managers. For example, cutting down on greenhouse gases has already provided economic savings to both the public and private sectors.

In addition, approaches to climate change adaptation can be incorporated into the management of the city's infrastructure, such as recalibrating building design standards to include climate change projections, expanding the legal framework governing the design and operation of infrastructure to include the impacts of climate change, and engaging with the insurance industry so that it contributes to adaptation strategies by creating products that respond to and recognize long-term risks.

The NPCC suggests that all agencies and organizations that manage infrastructure adaptation strategies should draw from a range of responses, including adjustments in operations and management, capital investments in infrastructure, and development of policies that promote flexibility.

The NPCC proposes several recommendations for action, focusing on critical infrastructure and alignment with broader-scale actions, including the creation of a climate change monitoring program to track and analyze key climate change factors, impacts, and adaptation indicators across the city, as well as studying rele
'/>"/>

Contact: Ben Norman
Lifesciencenews@wiley.com
44-012-437-70375
Wiley-Blackwell
Source:Eurekalert

Page: 1 2 3

Related biology news :

1. Climate change goes underground
2. Opportunity for students displaced by Katrina to assess climate vulnerability of Southeast US
3. Climate -- no smoking gun for Neanderthals
4. NASA celebrates a decade observing climate impacts on health of worlds oceans
5. NASA celebrates a decade observing climate impacts on health of worlds oceans
6. University and state agencies to forecast local health effects of climate change
7. A greenhouse in order to study the impact of climate change on plants
8. European lead in reading past climates from ice cores
9. International team of scientists warns of climate changes impact on global river flow
10. Heaps of climate gas
11. Nobel Peace Prize 2007 to intergovernmental panel on climate change
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/17/2014)... 16, 2014 Valencell, a leader in performance ... technology to industry leaders such as Intel, Jabra, Atlas, ... biometric wearable products. These products will be showcased at ... Las Vegas . "Our partners ... and robust – with the clinical data to back ...
(Date:12/11/2014)... --Research and Markets , ... ) has announced the addition of the ... their offering. One major trend ... multimodal biometric systems. Multimodal biometric systems utilize more ... and identification purposes. This helps to reduce the ...
(Date:12/10/2014)... , Dec. 9, 2014  Wake Forest Baptist Medical ... building for its School of Medicine. Funding for this ... capital campaign that will be publicly launched next summer. ... located in the former 60 series R.J. Reynolds Tobacco ... Quarter. Construction will begin immediately with plans to be ...
Breaking Biology News(10 mins):Valencell PerformTek Biometrics Power the Most Accurate Wearables at CES 2015 2Biometrics Market in India 2015-2019: Key Vendors are 3M Cogent, NEC, Safran and Suprema 2Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 2Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 3Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 4
... conducted by researchers at The University of Texas School ... abuse and dependence among Hispanic male populations in the ... along the U.S.-Mexico border. The expansion is supported ... on Alcohol Abuse and Alcoholism of the National Institutes ...
... book Artificial Gravity , edited by Gilles Clment and ... from the International Academy of Astronautics. This award is given ... the Academy in the fields related to life science. The ... on 28 September 2008 in Glasgow, Scotland. Artificial ...
... 2008) Just three years after it was discovered, a ... the Wildlife Conservation Society, which recently published the first-ever census ... the large, forest-dwelling primate hovers at 1,117 individuals, according to ... Oryx . The population estimate was the ...
Cached Biology News:Survey of Hispanics and alcohol dependence 2
(Date:12/17/2014)... (PRWEB) December 17, 2014 Gene ... that it has entered into a technology access ... (ADM) to apply DNA2.0’s proprietary protein engineering technology, ... process. , “We are extremely excited that the ... platform. This proprietary bioengineering technology has now ...
(Date:12/17/2014)... SOUTH SAN FRANCISCO, Calif. , Dec. 17, ... positive results of a Phase 2 study evaluating ... for the treatment of patients with severe, chronic ... the current standard of care, including topical steroids ... endpoint was percent change in Visual Analog Scale ...
(Date:12/15/2014)...  GlassesOff Inc. (OTCBB: GLSO) announced today the appointment ... director of the Company,s Board of Directors. ... its CEO until its acquisition by Stanley Black ... Recognized as the inventor of the first Wi-Fi-based Active ... -based RFID solutions focused on improving operational efficiency, safety ...
(Date:12/13/2014)... (PRWEB) December 12, 2014 Clarassance, a ... announced its new name: Therabron Therapeutics , Inc. ... and bronchioles (a type of structure in the lungs ... company’s mission to develop novel protein therapeutics for the ... directors decided to change the name to mark the ...
Breaking Biology Technology:ADM and DNA2.0 Enter Into Protein Engineering Technology Access and Service Agreement 2Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 2Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 3Velocity Pharmaceutical Development, LLC and Tigercat Pharma, Inc. Announce Phase 2 Results for VPD-737 in Patients With Chronic Pruritus 4AeroScout Founder Joins GlassesOff's Board of Directors 2AeroScout Founder Joins GlassesOff's Board of Directors 3Maryland-based Biotech Company's Path Forward in Treating Respiratory Diseases Sparks Name Change 2
... , , , , , , ... , 1Thermo Finnigan, Piscataway, NJ; , ... , Chemical Structure Validation , ... of ion trap mass spectrometers , , ...
... , , , , , , David Barnidge ... , Neuromics, Inc., Minneapolis, MN , ... , ICAT Analysis , , , ... ProteomeX integrated proteomics workstation., , , , , , ...
... , , , , , ... Center for Neurologic Diseases, Brigham and Womens Hospital, Harvard , ... , , , Genetic manipulations using neuronal cells ... RNA (siRNA) , to primary neuronal cultures is of critical ...
Cached Biology Technology:Analyzing Trace-Level Impurities of a Pharmaceutical Intermediate Using , an LCQ Deca Ion Trap Mass Spectrometer and the Mass Frontier , Software Package 2Analyzing Trace-Level Impurities of a Pharmaceutical Intermediate Using , an LCQ Deca Ion Trap Mass Spectrometer and the Mass Frontier , Software Package 3Analyzing Trace-Level Impurities of a Pharmaceutical Intermediate Using , an LCQ Deca Ion Trap Mass Spectrometer and the Mass Frontier , Software Package 4Analyzing Trace-Level Impurities of a Pharmaceutical Intermediate Using , an LCQ Deca Ion Trap Mass Spectrometer and the Mass Frontier , Software Package 5Analyzing Trace-Level Impurities of a Pharmaceutical Intermediate Using , an LCQ Deca Ion Trap Mass Spectrometer and the Mass Frontier , Software Package 6Analyzing Trace-Level Impurities of a Pharmaceutical Intermediate Using , an LCQ Deca Ion Trap Mass Spectrometer and the Mass Frontier , Software Package 7Analyzing Trace-Level Impurities of a Pharmaceutical Intermediate Using , an LCQ Deca Ion Trap Mass Spectrometer and the Mass Frontier , Software Package 8Analyzing Trace-Level Impurities of a Pharmaceutical Intermediate Using , an LCQ Deca Ion Trap Mass Spectrometer and the Mass Frontier , Software Package 9Quantification of the Purinergic Receptor P2X3 using ICAT and , Orthogonal 2D LC-MS/MS with an Ion Trap Mass Spectrometer 2Quantification of the Purinergic Receptor P2X3 using ICAT and , Orthogonal 2D LC-MS/MS with an Ion Trap Mass Spectrometer 3Quantification of the Purinergic Receptor P2X3 using ICAT and , Orthogonal 2D LC-MS/MS with an Ion Trap Mass Spectrometer 4Quantification of the Purinergic Receptor P2X3 using ICAT and , Orthogonal 2D LC-MS/MS with an Ion Trap Mass Spectrometer 5Quantification of the Purinergic Receptor P2X3 using ICAT and , Orthogonal 2D LC-MS/MS with an Ion Trap Mass Spectrometer 6Quantification of the Purinergic Receptor P2X3 using ICAT and , Orthogonal 2D LC-MS/MS with an Ion Trap Mass Spectrometer 7Efficient RNAi-mediated gene silencing in neuronal cells using QIAGEN , siRNA and TransMessenger Transfection Reagent* 2Efficient RNAi-mediated gene silencing in neuronal cells using QIAGEN , siRNA and TransMessenger Transfection Reagent* 3Efficient RNAi-mediated gene silencing in neuronal cells using QIAGEN , siRNA and TransMessenger Transfection Reagent* 4Efficient RNAi-mediated gene silencing in neuronal cells using QIAGEN , siRNA and TransMessenger Transfection Reagent* 5
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
... raised against a partial recombinant ... PPP4C (NP_002711, 218 a.a. ... protein with GST tag. ... NM_002720 Protein ...
Mouse monoclonal antibody raised against a partial recombinant CAPG. NCBI Entrez Gene ID = CAPG...
Biology Products: