Navigation Links
Heart health through gut health
Date:2/6/2014
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
Heart health through gut health
(Date:6/23/2015)... 2015   MedNet Solutions , an innovative ... spectrum of clinical research, is pleased to announce ... the company,s intuitive, flexible and affordable cloud-based eClinical ... Stevie® Award by the American Business Awards ... category.  The American Business Awards are considered the ...
(Date:6/23/2015)... June 23, 2015  Crossmatch™, a leading ... today announced enhanced functionality of its DigitalPersona ... The enhancements build on the native flexibility ... Altus platform and provide expanded mobile credential ... In today,s environment of increasing cyber-attacks and ...
(Date:6/17/2015)... Deutschland und GERMANTOWN, Maryland , June ... ®   Produktlinie mit DNA-Tests verbessert den ... (NASDAQ: QGEN ; Frankfurt Prime Standard: QIA) hat ... STR-Testkits der Produktlinie Investigator ® ... Markt eingeführt. Die neuen Kits zur Erstellung genetischer Fingerabdrücke ...
Breaking Biology News(10 mins):MedNet Solutions' iMedNet eClinical Wins Silver Stevie Award 2Crossmatch Releases Enhanced DigitalPersona Altus Advanced Authentication Functionality 2QIAGEN bringt in den USA neue Kits für die forensische DNA-Analyse auf den Markt 2QIAGEN bringt in den USA neue Kits für die forensische DNA-Analyse auf den Markt 3QIAGEN bringt in den USA neue Kits für die forensische DNA-Analyse auf den Markt 4QIAGEN bringt in den USA neue Kits für die forensische DNA-Analyse auf den Markt 5QIAGEN bringt in den USA neue Kits für die forensische DNA-Analyse auf den Markt 6
... factor only just beginning to be appreciated by social ... Terje Tvedt, of the Universities of Oslo and Bergen, ... role in shaping societies throughout human history. Speaking at ... in October, Tvedt proposed that social scientists and historians ...
... vice president for technology development at NJIT, has been ... and Technology to assist faculty researchers with the most ... $50,000. The money, known as Gap grants, is ... idea and a commercial product. Sixteen grants ...
... Carolina at Chapel Hill researchers using brain imaging of ... that may mark the onset of autistic symptoms is ... in funding. , The Infant Brain Imaging Study ... awarded $10 million in 2007 by the National Institutes ...
Cached Biology News:Using water to understand human society, from the industrial revolution to global trade 2Using water to understand human society, from the industrial revolution to global trade 3Moving new technologies from the lab to the marketplace 2Moving new technologies from the lab to the marketplace 3UNC expands brain imaging study of infants at risk for autism 2
(Date:7/2/2015)... 2, 2015  Spherix Incorporated (Nasdaq: SPEX ) -- an ... monetization of intellectual property, today announced a litigation update. ... v. Verizon Services Corp. et al. , Case No. ... Eastern District of Virginia , the ... interpreting certain key claims in favor of the Defendants ...
(Date:7/1/2015)... ... July 01, 2015 , ... It is now possible ... using single photon emission computed tomography (SPECT) according to researchers from Amen ... examined over 20,000 brain scans and is believed to be the largest brain imaging ...
(Date:7/1/2015)... AURORA, Colo. and BANGALORE, India ... a global genomic profiling company that uses next generation ... appointment of Scott A. Storrer as chief ... and CEO, he will be responsible for all strategy, ... Vijay Chandru , who has served as Strand,s chairman ...
(Date:7/1/2015)... ... July 01, 2015 , ... A newly launched business plan contest ... the barriers to innovation in life sciences R&D. The Pistoia Alliance President’s Startup Challenge ... of US$15,000 and a period of expert mentorship from a senior industry figure drawn ...
Breaking Biology Technology:Spherix Issues A Litigation Update 2Spherix Issues A Litigation Update 3Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 2Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 3Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 4Strand Life Sciences Names Scott A. Storrer CEO as Company Continues Global Expansion with Focus on Precision Medicine Product 2Strand Life Sciences Names Scott A. Storrer CEO as Company Continues Global Expansion with Focus on Precision Medicine Product 3Pistoia Alliance Launches Startup Challenge 2Pistoia Alliance Launches Startup Challenge 3
... M.S., , ... , INTRODUCTION , Immunoassays ... samples were necessary to ensure that they fell within the ... improved sensitivity and dynamic range, have become commercially available 1 ...
... Michael Su, M.S., ... , INTRODUCTION , Adenosine triphosphate ... assay of ATP can be used as a indicator of viable ... planthygiene for bacterial contamination in the food, drug, health care and ...
... INTRODUCTION , ... manufacturers stated specifications 1- 5 and pipetting is a ... properly. Accuracy and precision specifications typically provided by pipettor manufacturers are ... different due to the varying technical skills of the operators, environmental ...
Cached Biology Technology:High Sensitivity, Wide Dynamic Range, Horseradish Peroxidase (HRP) ELISA Using the LMax Microplate Luminometer (MaxLine Application Note #41) 2High Sensitivity, Wide Dynamic Range, Horseradish Peroxidase (HRP) ELISA Using the LMax Microplate Luminometer (MaxLine Application Note #41) 3ATP Quantitation in the LMax Microplate Luminometer (MaxLine Application Note #40) 2ATP Quantitation in the LMax Microplate Luminometer (MaxLine Application Note #40) 3ATP Quantitation in the LMax Microplate Luminometer (MaxLine Application Note #40) 4Verifying Multichannel Pipettor Performance with Standard Dispense Solutions in the SpectraMax Plus (MaxLine Application Note #28) 2Verifying Multichannel Pipettor Performance with Standard Dispense Solutions in the SpectraMax Plus (MaxLine Application Note #28) 3Verifying Multichannel Pipettor Performance with Standard Dispense Solutions in the SpectraMax Plus (MaxLine Application Note #28) 4Verifying Multichannel Pipettor Performance with Standard Dispense Solutions in the SpectraMax Plus (MaxLine Application Note #28) 5Verifying Multichannel Pipettor Performance with Standard Dispense Solutions in the SpectraMax Plus (MaxLine Application Note #28) 6Verifying Multichannel Pipettor Performance with Standard Dispense Solutions in the SpectraMax Plus (MaxLine Application Note #28) 7Verifying Multichannel Pipettor Performance with Standard Dispense Solutions in the SpectraMax Plus (MaxLine Application Note #28) 8Verifying Multichannel Pipettor Performance with Standard Dispense Solutions in the SpectraMax Plus (MaxLine Application Note #28) 9Verifying Multichannel Pipettor Performance with Standard Dispense Solutions in the SpectraMax Plus (MaxLine Application Note #28) 10Verifying Multichannel Pipettor Performance with Standard Dispense Solutions in the SpectraMax Plus (MaxLine Application Note #28) 11Verifying Multichannel Pipettor Performance with Standard Dispense Solutions in the SpectraMax Plus (MaxLine Application Note #28) 12Verifying Multichannel Pipettor Performance with Standard Dispense Solutions in the SpectraMax Plus (MaxLine Application Note #28) 13Verifying Multichannel Pipettor Performance with Standard Dispense Solutions in the SpectraMax Plus (MaxLine Application Note #28) 14Verifying Multichannel Pipettor Performance with Standard Dispense Solutions in the SpectraMax Plus (MaxLine Application Note #28) 15
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
... antibody raised against a partial ... Immunogen: PPP4C (NP_002711, 218 ... recombinant protein with GST tag. ... NM_002720 ...
Biology Products: