Navigation Links
Global Viral Forecasting Initiative receives $11M to implement pandemic early warning system
Date:10/20/2008

The Global Viral Forecasting Initiative (GVFI), a nonprofit research initiative dedicated to preventing pandemics, has received $11 million dollars from Google.org and The Skoll Foundation. The support, which includes $5.5 million dollars from each organization, represents the largest grant to date from Google.org.

GVFI, an organization whose mission it is to prevent future pandemics before they become fully established, brings together fieldwork in disease hotspots throughout the world with cutting edge laboratory science aimed at the discovery of new pathogens.

"Pandemics pose an enormous threat to us all," said Sally Osberg, President and CEO of the Skoll Foundation. "Often, by the time a new virus is discovered, it's too late to contain it. The innovative Global Viral Forecasting Initiative is aimed at finding dangerous viruses when it is still possible to limit their spread. The Skoll Foundation is proud to support this pioneering and important work."

Through collaborative studies in Cameroon, China, Democratic Republic of Congo, Lao PDR, Madagascar, and Malaysia, GVFI tracks emergent pandemics to their source, working to provide potentially vital months or years of advanced warning before the next HIV or SARS emerges on the global stage.

"The 1918 flu outbreak cost more lives than World War I. Most epidemiologists agree - and worry - that the world is overdue for another dangerous flu pandemic," says Dr. Larry Brilliant, Executive Director of Google.org. "The cutting-edge work of Nathan Wolfe and his network of public health stars may be one of the world's best bets to prevent the next pandemic."

GVFI's strategy for preventing pandemics comes out of more than a decade of research by its founder and director, Dr. Nathan Wolfe, who holds the Lorry I. Lokey Visiting Professorship in Human Biology at Stanford University. Utilizing $2.5m in seed funding from the prestigious NIH Director's Pioneer Award Dr. Wolfe an
'/>"/>

Contact: Susan Campos
scampos@gvfi.com
310-279-2498
GVFI.org
Source:Eurekalert

0

GOOD

Page: 1 2

Related biology news :

1. Global Warming and the Habitability of Planet Earth, Sept. 26
2. Green skies: Engineers work may reduce jet travels role in global warming
3. Scientists in first global study of poison gas in the atmosphere
4. North Americas northernmost lake affected by global warming
5. IEEE-USA innovation forum will help prepare US tech leaders to prosper in a global marketplace
6. Majority of Americans want local action on global warming, says poll
7. International team of scientists warns of climate changes impact on global river flow
8. Changing the global dietary environment
9. Global deal fuels QUTs world-changing research
10. NIH hosts event to launch Council of Science Editors global theme issue
11. Agricultural soil erosion is not adding to global warming
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/19/2013)... Course at the Marine Biological Laboratory (MBL), Woods ... Microbiology site by the American Society for Microbiology ... recognizes institutions and the scientists who worked there ... science of microbiology. A ceremony unveiling the ... for Saturday, June 22, 2013, at 4:30 pm ...
(Date:6/19/2013)... University of Pittsburgh has developed antibacterial compounds, derived ... be potential treatments for drug-resistant bacterial infections and ... are quite small, making them inexpensive and easy ... June 2013 issue of the journal Antimicrobial ... many probable applications will likely be the chronic ...
(Date:6/19/2013)... June 19, 2013 A decade-long JDRF-funded study ... Helmholtz Zentrum Mnchen, Germany, is providing a deeper ... risk of developing type 1 diabetes (T1D), highlighting ... for the disease. The study, "Seroconversion to Multiple ... in Children," was published today in The ...
Breaking Biology News(10 mins):Microbial diversity course designated as a 'Milestones in Microbiology' site 2HIV-derived antibacterial shows promise against drug-resistant bacteria 2New data on islet autoantibodies in young children defines early type 1 diabetes development 2
... that the loss of a gene called p63 accelerates aging ... many organisms, including humans. Therefore, the p63 gene is likely ... "To study how the p63 gene works, we devised a ... us right away was that these p63 deficient mice were ...
... study has followed a single humpback whale from one ... the migratory patterns of these majestic marine mammals in ... Society (WCS), the American Museum of Natural History (AMNH), ... Society's Biology Letters, a male humpback whale that was ...
... the introduction of the varicella (chicken pox) vaccine in ... have dropped dramatically, according to a study in the ... recommended for routine immunization of children aged 12 to ... in the United States, according to background information in ...
Cached Biology News:Gene loss accelerates aging 2Genetics links whale to two different ocean basins 2Hospitalizations because of chicken pox down dramatically since implementation of vaccine 2Hospitalizations because of chicken pox down dramatically since implementation of vaccine 3
(Date:6/19/2013)... , June 19, 2013 ... ) has announced the addition of the ... Opportunities, 2018" report to their offering. ... Lack of data protection and old ... PIN codes have driven the growth of ...
(Date:6/19/2013)... -- Continuing its long history of proven clinical performance in ... Inc. announces the U.S. Food and Drug Administration (FDA) ... assay for use on its Access 2 immunoassay system. ... Coulter,s troponin I test for over 12 years ... to continue providing dependability to laboratories supporting emergency care," ...
(Date:6/19/2013)... 2013 Biotechnology industry pioneer Amgen (NASDAQ: ... provider BlackLine Systems  and enterprise application software leader ... a webinar next week entitled "No Account Left Behind!  ... SAP to Help Keep Its Account Reconciliations in Good Shape ... The webinar, geared at finance, accounting, audit and ...
(Date:6/19/2013)... (PRWEB) June 19, 2013 Applied Rigaku ... report that details the measurement of sulfur in ultra-low ... QC+ high resolution benchtop EDXRF analyzer . The analysis ... test method ISO 13032. This International Standard specifies ... the determination of sulfur content in automotive gasoline. , ...
Breaking Biology Technology:Global Biometric Systems Market Forecast Report - Opportunities to 2018 2Global Biometric Systems Market Forecast Report - Opportunities to 2018 3Beckman Coulter Announces FDA Clearance of New Access AccuTnI+3 Troponin I Assay for the Access 2 Immunoassay System 2Beckman Coulter Announces FDA Clearance of New Access AccuTnI+3 Troponin I Assay for the Access 2 Immunoassay System 3Amgen Joins BlackLine Systems, SAP for Webinar on Automating Account Reconciliations 2Amgen Joins BlackLine Systems, SAP for Webinar on Automating Account Reconciliations 3Amgen Joins BlackLine Systems, SAP for Webinar on Automating Account Reconciliations 4Rigaku Publishes New Application Note for Analysis of ULSD Per ISO 13032 2
... Calif., May 8 Edwards Lifesciences,Corporation (NYSE: EW ... valves,announced that the company will celebrate a number of ... meeting of the American,Association for Thoracic Surgery (AATS), May ... by Edwards -- which this year celebrates,its 50th anniversary ...
... ALTO, Calif., May 8 Telik, Inc. (Nasdaq:,TELK) today ... per share, for,the first quarter ended March 31, 2008, ... per share, for the comparable period in 2007., ... costs and,expenses were $10.6 million, compared with $18.0 million ...
... Md., May 8 The Maryland Stem Cell,Research ... 122,applications in response to its three official Requests ... Maryland Technology Development,Corporation (TEDCO) reviewed the Commission,s recommendations ... Maryland Stem Cell Research,Fund (MSCRF) under the Maryland ...
Cached Biology Technology:Edwards Lifesciences Celebrates One Million Heart Valve Patients and More at AATS 2008 2Edwards Lifesciences Celebrates One Million Heart Valve Patients and More at AATS 2008 3Edwards Lifesciences Celebrates One Million Heart Valve Patients and More at AATS 2008 4Telik Announces First Quarter 2008 Financial Results 2Telik Announces First Quarter 2008 Financial Results 3Maryland Stem Cell Research Commission Recommends 62 Projects for Funding 2Maryland Stem Cell Research Commission Recommends 62 Projects for Funding 3
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products: