Navigation Links
GEOLOGY returns to Naica Cave, Mexico, and extends its reach to Mercury
Date:12/21/2012

sses change through time. Yet, the basic model's key predictions have never been tested rigorously using numerical dating methods that allow for quantification of changes in the pace at which sedimentary strata accumulate. This report, focused on the recent geological past (latest Quaternary), shows that direct dating of fossil shells provides direct quantitative estimates on the temporal resolution, frequency of bed-forming events and sedimentation rates at the level of individual strata. In addition, this dating effort confirms that the quality of fossil record is strongly influenced by glacio-eustatic sea-level changes. The extensive dating of shells from Po Plain sediments highlights the fact that the changes in sea level not only may produce distinct sequence stratigraphic architectures, but also affect the quality, quantity, and the temporal nature of paleontological and sedimentological records.

Very little water is necessary to make a dry solid silicate system wet

Ralf Milke et al., Institut fr Geologische Wissenschaften, Freie Universitt Berlin, Malteserstrasse 74-100, 12249 Berlin, Germany. Posted online 30 Nov. 2012; http://dx.doi.org/10.1130/G33674.1.

The standard rim-forming mineral reaction olivine + quartz = orthopyroxene has been experimentally performed at very dry conditions, i.e., only 20 wt ppm of water present in the sample container as a fluid, and most "water" was hydrogen dissolved within the solid crystals. Reaction rates and resulting fabrics at olivine-quartz interfaces mimic reaction features previously known from water-rich conditions (tens of thousands ppm). This experiment by Ralf Milke and colleagues indicates that very small amounts of water (tens of ppm of the entire sample) are highly effective in facilitating mineral reactions where water acts as a catalyst and creates porosity that might start to migrate from the initial cent
'/>"/>

Contact: Kea Giles
kgiles@geosociety.org
Geological Society of America
Source:Eurekalert

0

GOOD

Page: 1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17 18 19 20

Related biology news :

1. Seismic zones, river deltas, landslides, fossil reptiles, and more new Geology science
2. From 503-million-year-old fungi to recent earthquakes: New Geology posted ahead of print
3. Sandy beaches, hydrocarbon reservoirs, tectonic tilting: Its all about geology
4. Geosphere: How geology, technology, modeling, and mapping see into Earths past and present
5. Geologys Mystery Interval, the Great Deepening, and the largest kill-off in Earth history
6. GEOLOGY adds 30 new articles online
7. GEOLOGY speeding top science to online platform
8. GSA Bulletin presents studies in Antarctica, Italy, Mexico, Algeria, Mongolia, and more
9. Exclusive agreement to distribute Affinity Biosensors Archimedes system extends Malvern Instruments biopharma solutions
10. $1 million Kenan Trust Grant extends support of Scripps Florida education outreach
11. Effects of environmental toxicants reach down through generations
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/19/2013)... MOUNTAIN VIEW, Calif. , June 20, 2013 ... the personalized cosmeceuticals market, Frost & Sullivan recognizes ... Sullivan Award for New Product Innovation. geneOnyx leverages ... point-of-care testing to create an on-the-spot genetic test ... only a single-step DNA collection procedure from saliva ...
(Date:6/19/2013)... is playing a vital role in the survival of ... to climate and environmental changes, according to new research ... savannah birds from the Tanzanian Bird Atlas project - ... - the researchers found that they are using protected ... further west where dry seasons are getting longer, with ...
(Date:6/19/2013)... 19, 2013   Mercy Medical Center ... technology for conducting on-demand, Hemoglobin A 1c ... well as analysis of important red blood ... The new system enables the hospital to ... physicians and their patients, which can improve ...
Breaking Biology News(10 mins):Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 2Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 3Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 4Protected areas provide African birds with stepping stones to survival 2Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 2Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 3Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 4
... in biomedical science are on the horizon with ... Infrastructure (Instruct) in support of European biomedical research. ... (ESFRI) is involved in establishing about 40 such ... is one such biomedical project, whose aim is ...
... center responsible for responding goes into gear, setting off a ... from the adrenal glands. Dr. Gil Levkowitz ... now revealed a new kind of ON-OFF switch in the ... from the brain that stimulates cortisol release in the body. ...
... by a University of California, Davis, plant scientist delivers a ... world-renowned wine industry. The study is set for publication ... the Proceedings of the National Academy of Sciences. "Many ... plant, but we believe that most microbes would have difficulty ...
Cached Biology News:European Integrated Structural Biology Infrastructure launching 2A unique on-off switch for hormone production 2Fused genes tackle deadly Pierce's disease in grapevines 2
(Date:6/19/2013)... 19, 2013  Continuing its long history of proven ... Beckman Coulter , Inc. announces the U.S. Food and ... AccuTnI+3 troponin I assay for use on its Access ... on Beckman Coulter,s troponin I test for ... the proven performance to continue providing dependability to laboratories ...
(Date:6/19/2013)... Bayer CropScience will honor Illinois beekeeper Steve McNair ... Award. The award will be announced at Bayer’s ... an event where supporters of pollinator health celebrate the ... , The Bayer Bee Care Community Leadership Award recognizes ... bee colony to benefit their community. Applicants are judged ...
(Date:6/19/2013)... LOS ANGELES , June 19, 2013 Biotechnology ... is teaming up with financial software provider BlackLine Systems ... (NYSE: SAP ) for a webinar next week ... Amgen Uses Solutions from BlackLine and SAP to Help Keep ... (Logo: http://photos.prnewswire.com/prnh/20061117/LAF027LOGO ) The webinar, ...
(Date:6/19/2013)... Indiana (PRWEB) June 19, 2013 ... joined the speaking faculty at 2013’s BioLogistics Summit ... The conference, coordinated by Cold Chain IQ and ... biologics. This “complexity” is, in part, attributed to ... , “Implicit within these trends is an ...
Breaking Biology Technology:Beckman Coulter Announces FDA Clearance of New Access AccuTnI+3 Troponin I Assay for the Access 2 Immunoassay System 2Beckman Coulter Announces FDA Clearance of New Access AccuTnI+3 Troponin I Assay for the Access 2 Immunoassay System 3Community Mentor Wins Inaugural Bayer CropScience Bee Care Leadership Award 2Community Mentor Wins Inaugural Bayer CropScience Bee Care Leadership Award 3Community Mentor Wins Inaugural Bayer CropScience Bee Care Leadership Award 4Amgen Joins BlackLine Systems, SAP for Webinar on Automating Account Reconciliations 2Amgen Joins BlackLine Systems, SAP for Webinar on Automating Account Reconciliations 3Amgen Joins BlackLine Systems, SAP for Webinar on Automating Account Reconciliations 4BioConvergence® Presents at BioLogistics Summit on Risk Matrix for Biosamples during Shipment 2
... MOUNTAIN VIEW, Calif., Jan. 17, 2012  MAP Pharmaceuticals, Inc. (Nasdaq: ... James O,Shea to its Board of Directors. Mr. O,Shea brings ... product commercialization and operations. "We are privileged to ... time in the Company,s development as we focus our efforts ...
... 16, 2012 Luminex Corporation (Nasdaq: LMNX ) ... fourth quarter and full year 2011 on Monday, February 6, ... release after the close of trading. (Logo: ... conference call to discuss the operating highlights and financial results ...
... 2012 Elsevier, a world-leading provider ... services, announced today that its first bilingual platform of ... , is now available online. NursingChina ... available in China, featuring skills within specialties such ...
Cached Biology Technology:MAP Pharmaceuticals Appoints W. James O'Shea to Board of Directors 2MAP Pharmaceuticals Appoints W. James O'Shea to Board of Directors 3Luminex Corporation Fourth Quarter and Full Year 2011 Earnings Release Scheduled for February 6, 2012 2Luminex Corporation Fourth Quarter and Full Year 2011 Earnings Release Scheduled for February 6, 2012 3Elsevier Launches Bilingual International Nursing Skill Training and Management Platform: NursingChina.com 2Elsevier Launches Bilingual International Nursing Skill Training and Management Platform: NursingChina.com 3
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products: