Navigation Links
Forest fire prevention efforts will lessen carbon sequestration, add to greenhouse warming
Date:7/8/2009

y off best and what values are most important."

The report was just published in Ecological Applications, a professional journal. The lead author was Stephen Mitchell, who conducted the work as part of his doctoral thesis while at OSU, and is now at Duke University. Among the findings:

  • Fuel reduction treatments that have been proposed to reduce wildfire severity also reduce the carbon stored in forests;

  • On west side Cascade Range and Coast Range forests, which are wetter, the catastrophic fire return interval is already very long, and the additional levels of fuel accumulation have not been that unusual;

  • A wide range of fire reduction approaches, such as salvage logging, understory removal, prescribed fire and other techniques, can effectively reduce fire severity if used properly;

  • Such fuel removal almost always reduces carbon storage more than the additional carbon the stand is able to store when made more resistant to wildfire, in part because most of the carbon stored in forest biomass remains unconsumed even by high-severity wildfires;

  • Considerable uncertainty exists in modeling of future fires, and some fuel reduction techniques, especially overstory thinning treatments, could potentially lead to an increase in fire severity.

The study authors concluded that fuel reduction may still make more sense in east-side Cascade Range and other similar forests, but that the west-side Cascades and Coast Range have little sensitivity to forest fuel reduction treatments and might be best utilized for their high carbon sequestration capacities.

"Ultimately, the real problem here is global climate change," Harmon said. "Insect epidemics are increasing, trees are dying. There are no quick fixes to these issues."


'/>"/>

Contact: Mark Harmon
mark.harmon@oregonstate.edu
541-737-8455
Oregon State University
Source:Eurekalert

Page: 1 2 3

Related biology news :

1. Tropical insects go the distance to inform rainforest conservation
2. Rain forest protection works in Peru
3. New study warns limited carbon market puts 20 percent of tropical forest at risk
4. Humans fostering forest-destroying disease
5. Emphasis on conifer forests places multiple species at risk
6. Fireproofing homes dramatically reduces forest fire size, according to new study
7. Population movements and money remittances spur forest regrowth
8. Conservation International and Toyota partner to protect Philippines rain forests
9. Peat and forests save permafrost from melting
10. Amazon forest shows unexpected resiliency during drought
11. Spatial patterns in tropical forests can help to understand their high biodiversity
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:3/12/2015)... March 12, 2015 The mascots of the ... Hospital, part of Wake Forest Baptist Medical Center. They ... the 2015 ACC Men,s Basketball Tournament. Young patients enjoyed ... and getting their autographs. Brenner Children,s Hospital ... is the only children,s hospital in northwest ...
(Date:3/11/2015)...   The Sync Project™ today announced ... and harness music to improve health. The platform ... measurements of physiology, enabling the study of the ... populations. It is designed for medical and health ... studies and accelerate the discovery of the clinical ...
(Date:3/10/2015)...  NXT-ID, Inc. (NASDAQ: NXTD ... authentication company focused on the growing mobile commerce ... been named the "Number One Best Tech Gift ... Modern ( http://www.rethinkmodern.com/ ) is a web magazine focused ... that have a unique function or design.  ...
Breaking Biology News(10 mins):Introducing The Sync Project, a Global Collaboration Harnessing the Scientific Potential of Music for Health 2Introducing The Sync Project, a Global Collaboration Harnessing the Scientific Potential of Music for Health 3NXT-ID's Wocket Smart Wallet Named Number One Best Tech Gift for 2015 by Rethink Modern 2NXT-ID's Wocket Smart Wallet Named Number One Best Tech Gift for 2015 by Rethink Modern 3NXT-ID's Wocket Smart Wallet Named Number One Best Tech Gift for 2015 by Rethink Modern 4
... MADISON, WI, SEPTEMBER 21, 2009 A new ... , documents the history, science, and applications of tall ... increasing role in protecting soil and water and enhancing ... from around the world who address an array of ...
... after plucking the fossilized tooth of a new human ... team of scientists today (Thursday, Oct. 1) announced their ... Ardipithecus ramidus , which they say revolutionizes our understanding ... female skeleton, nicknamed Ardi, is 4.4 million years old, ...
... African bees were accidentally released in Brazil in 1957. ... at the Smithsonian Tropical Research Institute, began a 17-year ... to native bees than changes in the weather and ... , Scientists feared that dangerous swarms of Africanized bees ...
Cached Biology News:Tall fescue's future in agriculture 2Ardi displaces Lucy as oldest hominid skeleton 2Ardi displaces Lucy as oldest hominid skeleton 3Ardi displaces Lucy as oldest hominid skeleton 4Ardi displaces Lucy as oldest hominid skeleton 5Killer bees may increase food supplies for native bees 2
(Date:3/26/2015)... LANSING, Mich., March 26, 2015 Neogen Corporation ... income for the third quarter of fiscal 2015, which ... to the prior year,s $6,575,000. Earnings per share in ... year ago. Current year-to-date net income increased 17% over ... to $20,621,000, or $0.56 per share, for the same ...
(Date:3/26/2015)... 26, 2015 Ale Gicqueau, Founder and ... of Clinical Affairs at Align Technology, on “ Conducting ... upcoming ACRP 2015 Global Conference and Exhibition on April ... , During the poster presentation, Ale Gicqueau and ... running a Postmarket Registry, the requirements and resources to ...
(Date:3/25/2015)... TORONTO , March 25, 2015 /PRNewswire/ - SQI Diagnostics ... announced that, as a result of recent discussions with ... common shares of the Company, after dealing with certain ... and special meeting of shareholders on March 26, 2015 ... that the election of directors will take place when ...
(Date:3/25/2015)... Laboratory workers can turn to ... Balances to get best-performing features while still remaining ... from the trusted brand include: , Cole-Parmer ... efficiency by providing a large weighing surface for ... include parts counting, percent weighing, checkweighing, animal/dynamic weighing, ...
Breaking Biology Technology:Neogen reports 13% increase in net income 2Neogen reports 13% increase in net income 3Neogen reports 13% increase in net income 4Neogen reports 13% increase in net income 5Neogen reports 13% increase in net income 6Neogen reports 13% increase in net income 7Neogen reports 13% increase in net income 8Clinovo Presents at ACRP 2015 in Salt Lake City, Utah on April 25th-28th 2Clinovo Presents at ACRP 2015 in Salt Lake City, Utah on April 25th-28th 3SQI Diagnostics Inc. Announces New Nominees to SQI Diagnostics Board and Adjournment of Meeting 2SQI Diagnostics Inc. Announces New Nominees to SQI Diagnostics Board and Adjournment of Meeting 3SQI Diagnostics Inc. Announces New Nominees to SQI Diagnostics Board and Adjournment of Meeting 4SQI Diagnostics Inc. Announces New Nominees to SQI Diagnostics Board and Adjournment of Meeting 5New Economical Top-Loading and Analytical Symmetry Balances from Cole-Parmer 2
... -- Engineers at Ohio State University are developing a ... same material found in pencils. , Experts believe that ... graphite pencils -- holds the key to smaller, faster ... could enable new kinds of electronics. , Until now, ...
... March 31 Alseres Pharmaceuticals, Inc. (Nasdaq: ... of the Company,s independent registered public accounting firm ... explanatory paragraph regarding the Company,s ability to continue ... NASDAQ-traded companies to publicly announce if their Annual ...
... after heart attackAUSTIN, Texas, March 31 /PRNewswire/ ... Austin treated the first patient in the world ... test the effectiveness and safety of administering adult stem ... heart attack. Dr. Roger Gammon, a cardiologist with ...
Cached Biology Technology:Researchers find better way to manufacture fast computer chips 2Researchers find better way to manufacture fast computer chips 3Alseres Pharmaceuticals, Inc. Complies with NASDAQ Rule Regarding Recently Filed 10-K 2Alseres Pharmaceuticals, Inc. Complies with NASDAQ Rule Regarding Recently Filed 10-K 3Heart Hospital of Austin First Site in World to Test Efficacy of New Adult Stem Cell Therapy to Treat Damaged Heart Tissue in Phase II Trial 2
... Mouse polyclonal antibody raised against a ... FES (AAH35357, 120 a.a. ~ 250 ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products: