Navigation Links
First comprehensive genomic study of common cold reveals new treatment targets
Date:10/24/2008

lunteers (who served as the study control group) were given a sham inoculation in the form of a nasal saline spray. The volunteers were all healthy college students who signed informed consent forms. The rhinovirus-16 used in the study was first isolated and purified by Procter & Gamble and the University of Virginia.

After infection, researchers scraped small samples of nasal epithelial cells, which line the passages of the nose, from the volunteers. Rhinovirus-16 and other cold viruses infect these nasal cells, which are the body's first line of defense against airborne pathogens. The researchers then used microarray gene chip technology to compare the gene expression levels between the infected volunteers and the control group.

"Advances in genomics technology now allow us to analyze tens of thousands of genes in the same amount of time required to analyze just a handful of genes just a decade ago," said Jay Tiesman, P&G Genomics Group Leader and study author.

Forty-eight hours after inoculation, the expression of 6,530 genes in infected volunteers were significantly either up-regulated or down-regulated compared to the same genes in the control group. In other words, rhinovirus infection triggered a massive immune response in the nasal mucosa. Because rhinovirus is not as destructive as other more serious viral infections, this response appears to be disproportionate to the threat.

The researchers classified the active genes according to function, and found many involved in a process known as chemotaxis, which recruits various immune cells to the site of infection. These particular genes have been correlated with symptoms such as inflammation, congestion and runny nose. Other groups of active genes have also been classified; among them are genes which make antiviral compounds thought to help thwart infections.

"This study shows that after rhinovirus infection, cold symptoms develop because parts of our immune
'/>"/>

Contact: Shellie Byrum
sbyrum@spectrumscience.com
202-955-6222 x2516
Procter & Gamble
Source:Eurekalert

Page: 1 2 3

Related biology news :

1. Synaptics Reports Record Results for First Quarter of Fiscal 2009
2. Study of polar dinosaur migration questions whether dinosaurs were truly the first great migrators
3. Volcanoes may have provided sparks and chemistry for first life
4. Alzheimers disease research attracts first partner
5. Synaptics to Report First Quarter Results on October 23
6. Digital zebrafish embryo provides the first complete developmental blueprint of a vertebrate
7. Complete Genomics launches, becomes worlds first large-scale human genome sequencing company
8. New way to make malaria medicine also first step in finding new antibiotics
9. Whale songs are heard for the first time around New York City waters
10. ST Kinetics and NTU set up Southeast Asias first cold spray research center
11. INCF organizes the first congress dedicated to the emerging field of neuroinformatics
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/23/2015)... , June 22, 2015 ... announced the addition of the "Body-Worn Temperature ... Growth, Trends and Forecast 2014 - 2020" ... offers strategic analysis of the global body-worn temperature ... has been segmented on the basis of types, ...
(Date:6/23/2015)... , June 23, 2015  Crossmatch™, ... and authentication solutions, today announced enhanced functionality of ... authentication solution.  The enhancements build on the ... the DigitalPersona Altus platform and provide expanded ... In today,s environment of increasing ...
(Date:6/18/2015)... NXT-ID, Inc. (NASDAQ: NXTD ) ("NXT-ID" or ... mobile commerce market announces that its Wocket® smart wallet will ... the Mark", scheduled to air on WABC Radio (am770) in ... . The broadcast air- time for the ... EST. NXT-ID, Inc.,s CEO Gino Pereira will be ...
Breaking Biology News(10 mins):Body-Worn Temperature Sensors Market - Global Industry Analysis 2Crossmatch Releases Enhanced DigitalPersona Altus Advanced Authentication Functionality 2NXT-ID, Inc.'s CEO Gino Pereira Talks About the Wocket Smart Wallet on WABC Radio, New York City, June 20th 2NXT-ID, Inc.'s CEO Gino Pereira Talks About the Wocket Smart Wallet on WABC Radio, New York City, June 20th 3
... factor only just beginning to be appreciated by social ... Terje Tvedt, of the Universities of Oslo and Bergen, ... role in shaping societies throughout human history. Speaking at ... in October, Tvedt proposed that social scientists and historians ...
... vice president for technology development at NJIT, has been ... and Technology to assist faculty researchers with the most ... $50,000. The money, known as Gap grants, is ... idea and a commercial product. Sixteen grants ...
... Carolina at Chapel Hill researchers using brain imaging of ... that may mark the onset of autistic symptoms is ... in funding. , The Infant Brain Imaging Study ... awarded $10 million in 2007 by the National Institutes ...
Cached Biology News:Using water to understand human society, from the industrial revolution to global trade 2Using water to understand human society, from the industrial revolution to global trade 3Moving new technologies from the lab to the marketplace 2Moving new technologies from the lab to the marketplace 3UNC expands brain imaging study of infants at risk for autism 2
(Date:7/2/2015)... 2, 2015  Spherix Incorporated (Nasdaq: SPEX ) -- an ... monetization of intellectual property, today announced a litigation update. ... v. Verizon Services Corp. et al. , Case No. ... Eastern District of Virginia , the ... interpreting certain key claims in favor of the Defendants ...
(Date:7/1/2015)... ... July 01, 2015 , ... It is now possible ... using single photon emission computed tomography (SPECT) according to researchers from Amen ... examined over 20,000 brain scans and is believed to be the largest brain imaging ...
(Date:7/1/2015)... AURORA, Colo. and BANGALORE, India ... a global genomic profiling company that uses next generation ... appointment of Scott A. Storrer as chief ... and CEO, he will be responsible for all strategy, ... Vijay Chandru , who has served as Strand,s chairman ...
(Date:7/1/2015)... ... July 01, 2015 , ... A newly launched business plan contest ... the barriers to innovation in life sciences R&D. The Pistoia Alliance President’s Startup Challenge ... of US$15,000 and a period of expert mentorship from a senior industry figure drawn ...
Breaking Biology Technology:Spherix Issues A Litigation Update 2Spherix Issues A Litigation Update 3Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 2Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 3Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 4Strand Life Sciences Names Scott A. Storrer CEO as Company Continues Global Expansion with Focus on Precision Medicine Product 2Strand Life Sciences Names Scott A. Storrer CEO as Company Continues Global Expansion with Focus on Precision Medicine Product 3Pistoia Alliance Launches Startup Challenge 2Pistoia Alliance Launches Startup Challenge 3
... M.S., , ... , INTRODUCTION , Immunoassays ... samples were necessary to ensure that they fell within the ... improved sensitivity and dynamic range, have become commercially available 1 ...
... Michael Su, M.S., ... , INTRODUCTION , Adenosine triphosphate ... assay of ATP can be used as a indicator of viable ... planthygiene for bacterial contamination in the food, drug, health care and ...
... INTRODUCTION , ... manufacturers stated specifications 1- 5 and pipetting is a ... properly. Accuracy and precision specifications typically provided by pipettor manufacturers are ... different due to the varying technical skills of the operators, environmental ...
Cached Biology Technology:High Sensitivity, Wide Dynamic Range, Horseradish Peroxidase (HRP) ELISA Using the LMax Microplate Luminometer (MaxLine Application Note #41) 2High Sensitivity, Wide Dynamic Range, Horseradish Peroxidase (HRP) ELISA Using the LMax Microplate Luminometer (MaxLine Application Note #41) 3ATP Quantitation in the LMax Microplate Luminometer (MaxLine Application Note #40) 2ATP Quantitation in the LMax Microplate Luminometer (MaxLine Application Note #40) 3ATP Quantitation in the LMax Microplate Luminometer (MaxLine Application Note #40) 4Verifying Multichannel Pipettor Performance with Standard Dispense Solutions in the SpectraMax Plus (MaxLine Application Note #28) 2Verifying Multichannel Pipettor Performance with Standard Dispense Solutions in the SpectraMax Plus (MaxLine Application Note #28) 3Verifying Multichannel Pipettor Performance with Standard Dispense Solutions in the SpectraMax Plus (MaxLine Application Note #28) 4Verifying Multichannel Pipettor Performance with Standard Dispense Solutions in the SpectraMax Plus (MaxLine Application Note #28) 5Verifying Multichannel Pipettor Performance with Standard Dispense Solutions in the SpectraMax Plus (MaxLine Application Note #28) 6Verifying Multichannel Pipettor Performance with Standard Dispense Solutions in the SpectraMax Plus (MaxLine Application Note #28) 7Verifying Multichannel Pipettor Performance with Standard Dispense Solutions in the SpectraMax Plus (MaxLine Application Note #28) 8Verifying Multichannel Pipettor Performance with Standard Dispense Solutions in the SpectraMax Plus (MaxLine Application Note #28) 9Verifying Multichannel Pipettor Performance with Standard Dispense Solutions in the SpectraMax Plus (MaxLine Application Note #28) 10Verifying Multichannel Pipettor Performance with Standard Dispense Solutions in the SpectraMax Plus (MaxLine Application Note #28) 11Verifying Multichannel Pipettor Performance with Standard Dispense Solutions in the SpectraMax Plus (MaxLine Application Note #28) 12Verifying Multichannel Pipettor Performance with Standard Dispense Solutions in the SpectraMax Plus (MaxLine Application Note #28) 13Verifying Multichannel Pipettor Performance with Standard Dispense Solutions in the SpectraMax Plus (MaxLine Application Note #28) 14Verifying Multichannel Pipettor Performance with Standard Dispense Solutions in the SpectraMax Plus (MaxLine Application Note #28) 15
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
... antibody raised against a partial ... Immunogen: PPP4C (NP_002711, 218 ... recombinant protein with GST tag. ... NM_002720 ...
Biology Products: