Navigation Links
Fireflies and jellyfish help illuminate quest for cause of infertility
Date:3/27/2009

Genes taken from fireflies and jellyfish are literally shedding light on possible causes of infertility and autoimmune diseases in humans.

Scientists are using the luminescent and florescent genes to illuminate cells that produce a hormone linked to conditions, which include rheumatoid arthritis and lupus.

The technique will help scientists track the production of the hormone prolactin, which is crucial in ensuring supplies of breast milk in nursing mothers but can be overproduced by some pituitary tumours, causing infertility.

Prolactin has been linked to more than 300 biological functions. It is believed to play a role in autoimmune diseases, such as lupus and rheumatoid arthritis, as well as in the inflammation of cells and tissues.

Scientists from the Universities of Edinburgh, Manchester and Liverpool harnessed firefly and jellyfish genes, which enable these creatures to emit light, and used them to create a chemical reaction to light up cells expressing prolactin in rats.

The technique means that scientists can identify when and where prolactin is expressed to look at how the hormone works in real time.

Sabrina Semprini, whose study is published in the journal Molecular Endocrinology, said: "The lighting up of cells expressing this hormone will help us to understand its role within the body and could help research looking for treatments for conditions in which prolactin is involved."

The research, funded by the Wellcome Trust, identified cells producing prolactin throughout the body. This included the pituitary gland, the thymus an organ in the chest which helps protect against autoimmunity the spleen and inflammatory cells in the abdominal cavity.


'/>"/>

Contact: Tara Womersley
tara.womersley@ed.ac.uk
44-131-650-9836
University of Edinburgh
Source:Eurekalert

Page: 1

Related biology news :

1. New online report on massive jellyfish swarms released
2. Scientists discover stinging truths about jellyfish blooms in the Bering Sea
3. Fossil record reveals elusive jellyfish more than 500 million years old
4. Invasive Australian jellyfish sighted in Gulf of Mexico in summer 2007
5. Satellites illuminate pollutions influence on clouds
6. Variable light illuminates the distribution of picophytoplankton
7. New technology illuminates protein interactions in living cells
8. Films of Mitchell and Kenyon illuminate lefties decline in Victorian England
9. Understanding soil carbon sequestration: New book presents key concepts
10. Mountain on Mars may answer big question
11. New models question old assumptions about how many molecules it takes to control cell division
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:11/4/2014)... about the way our bodies are assembled during early ... they are supposed to become a nerve or a ... correct place and alignment? Researchers at the University of ... a new study, UM researchers describe the signaling systems ... at the head-trunk region. Their discovery may have important ...
(Date:11/4/2014)... , November 4, 2014   ... market growth   Fuel3D , a developer ... a funding round totaling $6.4 million (£4 million). This funding ... secured earlier this year and paves the way for the ... The funding round was led by Chimera Partners ...
(Date:11/4/2014)... , Nov. 4, 2014   Neurotechnology ... today announced that the latest version of its ... the Ongoing MINEX evaluation organized by ... fingerprint algorithms using the INCITS 378 fingerprint standard ... requirement in public tenders in the ...
Breaking Biology News(10 mins):The inside story: How the brain and skull stay together 2Fuel3D Secures $6.4 Million in Expansion Funding 2Fuel3D Secures $6.4 Million in Expansion Funding 3Neurotechnology Places Second in Ongoing MINEX Ranking for Fingerprint Matching Algorithms 2Neurotechnology Places Second in Ongoing MINEX Ranking for Fingerprint Matching Algorithms 3
... 9, 2009 Even small errors made by cells during protein ... ways to uncover these mistakes and correct them. Though in ... alaninenature has been extra careful, developing not one, but two ... is used correctly. Now, scientists at The Scripps ...
... to celebrate New Year,s Eve, drug industry executives will likely ... companies who make top-selling drugs for heart disease, asthma, and ... of mounting market pressures and a global recession. A timely ... scheduled for the current issue of Chemical & Engineering ...
... The University of Alabama used worms to reel in information ... cellular mechanisms that may be exploited to treat epilepsy. In ... ( http://www.genetics.org ), the researchers explain how the transparent roundworm, ... that control the transport of a molecule (gamma-aminobutyric acid or ...
Cached Biology News:Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 2Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 3Scripps Research team uncovers chemical basis for extra 'quality control' in protein production 4More than fish bait: Worms unlock secrets to new epilepsy treatments 2
(Date:11/24/2014)... Dallas, Texas (PRWEB) November 24, 2014 ... China Adipic Dihydrazide Industry is a professional and ... It provides Adipic Dihydrazide information, like its definition, ... as industry overview. This report covers the international ... as global (such as the US, Europe, Asia, ...
(Date:11/22/2014)... Audubon, PA and London (PRWEB) November 21, 2014 ... in December will explore what comes next for ALS research ... clinical sites. , After the Ice Bucket Challenge: Where ... Merit Cudkowicz, Date: Tuesday, 2 December 2014, Time: ... complimentary , Join expert speaker Dr. Merit Cudkowicz, Julianne ...
(Date:11/22/2014)... 21, 2014 On November 17th Chicago ... 2014 Emerging Medical Technologies Summit in San Francisco to ... Widely regarded among Silicon Valley investors and technology elites ... the win also positions Briteseed to move on ... in 2015 and compete with other elite innovation finalists ...
(Date:11/21/2014)... Quebec , November 21, 2014 ... como responsable comercial   Mariano Rodríguez es ...   KLOX está en marcha para comenzar ... de cura de heridas de reciente aprobación en Europa   ... "la compañía") se complace al anunciar los siguientes nombramientos: ...
Breaking Biology Technology:Adipic Dihydrazide Industry 2019 Research Forecasts on Worldwide, China Regions Now Available at ReportsnReports.com 2Adipic Dihydrazide Industry 2019 Research Forecasts on Worldwide, China Regions Now Available at ReportsnReports.com 3DrugDev Webinars in December to Explore What Comes Next for ALS Research and How We Can Make Life Easier for Clinical Sites 2Insight Product Development Accelerator Member Wins MedTech Innovator Award Competition 2Insight Product Development Accelerator Member Wins MedTech Innovator Award Competition 3KLOX Technologies anuncia sus nombramientos ejecutivos 2KLOX Technologies anuncia sus nombramientos ejecutivos 3KLOX Technologies anuncia sus nombramientos ejecutivos 4KLOX Technologies anuncia sus nombramientos ejecutivos 5
... Laura G. Leff, Department of Biological Sciences, Kent State,University, Kent, Ohio , ... Introduction , Assessing bacterial genetic ... because of difficulties in culturing native bacteria and the large number , ... physiological , traits of most microbes are ...
... and Li Tian, PhD, Bio-Rad Laboratories, 2000 Alfred,Nobel Drive, Hercules, CA 94547 USA, ... The Benchmark Plus microplate reader is a new ... that offers superior convenience, accuracy, and flexibility. , ... , feature has been designed in Microplate ...
, , , , , , back to top...
Cached Biology Technology:Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 2Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 3Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 4Analysis of Bacterial Assemblage Genetic Diversity in Environmental Samples Using the DCode System 5Benchmark Plus Microplate Reader Scan Well Feature 2Benchmark Plus Microplate Reader Scan Well Feature 3
... Staining Solution stains proteins in polyacrylamide ... limit >= 8 ng of protein) ... and destaining processes can be performed ... gel (20 min), proteins can be ...
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... antibody raised against a partial recombinant FES. ... 120 a.a. ~ 250 a.a) partial recombinant ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Accession Number: AAH35357 ...
Biology Products: