Navigation Links
Feats of strength begin a lizard's day
Date:8/28/2008

Male Jamaican anole lizards begin and end the day with displays of reptilian strength -- push-ups, head bobs and extensions of a colorful neck flap, or dewlap -- to defend their territory, according to a new study.

"Anoles are highly visual species, so in that sense it is not surprising that they would use visual displays to mark territory," said Terry J. Ord, a postdoctoral researcher at UC Davis and at Harvard University's Museum of Comparative Zoology. The lizards are the first animals known to mark dawn and dusk through visual displays, rather than the much better known chirping, tweeting, and other sounding off by birds, frogs, geckos and primates.

Ord studied four species of Jamaican forest lizard: Anolis lineatopus, Anolis sagrei, Anolis grahami, and Anolis opalinus. Females establish small territories allowing access to food and other resources, while males stake out larger territories allowing them access to several females. The males spend much of the day sitting on tree trunks and displaying head motions, push-ups, and dewlap extensions, all to warn other males away from their territory.

These displays of strength help avert actual physical confrontations between male lizards, which can be very fierce and destructive, Ord said.

Ord videotaped individual males at different times of day, from before dawn to dusk. In all four species, he found distinct peaks of activity at daybreak and for about two hours afterward, and again just before dark. Anoles leave their daytime perches at night to find safe shelter from nocturnal predators.

Scientists disagree on why birds chorus at dawn and dusk: competing ideas range from territorial defense to manifestations of circadian rhythms (the animal's internal clock). Ord said his work suggests male anoles use their morning displays primarily to mark territory.

"The dawn chorus may be a way of communicating having survived the night
'/>"/>

Contact: Andy Fell
ahfell@ucdavis.edu
530-752-4533
University of California - Davis
Source:Eurekalert  

Page: 1 2

Related biology news :

1. Armored fish study helps strengthen Darwins natural selection theory
2. ASM and FIND to partner on strengthening infectious disease diagnosis in developing nations
3. European Science Foundation aims to strengthen regenerative medicine
4. In Todays Economy, You Can Strengthen Your Company by Building Your Brand
5. Ibuprofen or acetaminophen in long-term resistance training increases muscle mass/strength
6. Strengthening the tumor-fighting ability of T cells
7. Proteins strength lies in h-bond cooperation
8. Woods Hole Research Center debuts new image mosaic that will strengthen global forest monitoring
9. Runners high may also strengthen hearts
10. Building a stronger roof over your head: 3 little pigs project begins first tests
11. 8-day undersea mission begins experiment to improve coral reef restoration
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
Feats of strength begin a lizard's day
(Date:12/10/2014)... NEW YORK , Dec. 8, 2014 You,ve ... online banking account but can,t remember your password, site key ... birthday? Who was your first grade teacher? ... launches the app that will finally put an ... PINs – 1U TM . 1U leverages a ...
(Date:12/10/2014)... Forest Baptist Medical Center today announced plans for a ... Funding for this $50 million capital project is part ... launched next summer. The medical education ... R.J. Reynolds Tobacco Company complex, adjacent to 525@vine in ... plans to be ready to welcome medical students in ...
(Date:12/10/2014)... , Dec. 08, 2014 Research and Markets ... addition of the "Biometrics Market in Japan ... http://photos.prnewswire.com/prnh/20130307/600769 The ... such as rural banking and upgradation of the ... witnessed in the market. Besides the aforementioned projects, ...
Breaking Biology News(10 mins):The Password is Finally Dead: Launch of 1U Mobile App Eliminates Need for All Usernames and Passwords 2The Password is Finally Dead: Launch of 1U Mobile App Eliminates Need for All Usernames and Passwords 3Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 2Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 3Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 4Biometrics Market in Japan 2014-2018: Key Vendors are DDS, Fujitsu, Hitachi and NEC 2
... 28, 2008) Just three years after it was discovered, ... to the Wildlife Conservation Society, which recently published the first-ever ... "kipunji," the large, forest-dwelling primate hovers at 1,117 individuals, according ... journal Oryx . The population estimate was ...
... at Houston say they are the first to provide ... may be an autoimmune disease. Their research could provide ... Findings appear online in Nature Medicine on ... Xia, M.D., Ph.D., an assistant professor of biochemistry and ...
... to dangerously low levels in diseases such as anemia ... cells, doctors filter platelets from donated blood, but this ... and cause other side effects in patients who need ... have been trying to generate platelets from embryonic stem ...
Cached Biology News:Pre-eclampsia may be autoimmune disease 2Pre-eclampsia may be autoimmune disease 3
(Date:12/24/2014)... “Preparative & Process Chromatography Market by Instrument ... Buffers, Valves, Guages, Seals), Accessories, Services, End User ... 2019” provides a detailed overview of the major ... strategies impacting the preparative and process chromatography market ... revenue and share analysis. , Full Copy ...
(Date:12/24/2014)... Island, New York (PRWEB) December 23, 2014 ... and the Long Island Affiliate of ITRA Global, the national ... slow but steady recovery. This is evidenced by the ... the strong stock market. Low energy costs have held ... The only negative is the housing market remaining soft. ...
(Date:12/24/2014)... , Dec. 23, 2014 China ... the "Company"), a leading fully integrated plasma-based biopharmaceutical ... announced that its majority-owned subsidiary, Shandong Taibang Biological ... ("GMP") certification from the China Food and Drug ... production facility. As previously disclosed in the Company,s ...
(Date:12/24/2014)... PARIS and NEW YORK ... data from its open-label pilot study of mazindol in ... Design, Development and Therapy in December 2014 . ... of mazindol in children with attention deficit/hyperactivity disorder" ( ... 2014 Dec 1;8:2321-2332. eCollection 2014 ) ...
Breaking Biology Technology:Preparative and Process Chromatography Market is expected to reach $9 billion by 2019 - New Report by Marketsandmarkets 2Preparative and Process Chromatography Market is expected to reach $9 billion by 2019 - New Report by Marketsandmarkets 3Preparative and Process Chromatography Market is expected to reach $9 billion by 2019 - New Report by Marketsandmarkets 4ITRA Global Reports Long Island Is Out of Sync With The National Office Market 2ITRA Global Reports Long Island Is Out of Sync With The National Office Market 3China Biologic Receives GMP Certification for New Coagulation Factor Facility 2China Biologic Receives GMP Certification for New Coagulation Factor Facility 3Redefining ADHD: A New Approach & A Shift of Paradigm in ADHD Therapeutics 2Redefining ADHD: A New Approach & A Shift of Paradigm in ADHD Therapeutics 3
... Polytechnic Institute Professor James Jian-Qiang Lu was recognized ... toward the design and realization of 3-D integrated ... Department of Electrical, Computer, and Systems Engineering (ECSE) ... D. Ashman Achievement Award for 2010 from the ...
... Intarcia Therapeutics. Inc today announced that Kurt ... presenting at the Lazard Capital Markets 7th Annual ... Tuesday, November 16, 2010 at 1:40pm local time ... (Logo:   http://photos.prnewswire.com/prnh/20050301/SFTU126LOGO ) ...
... 11, 2010 StemCyte, Inc., one of the world,s ... is proud to announce that the Company has been ... Internal Revenue Service,s Qualifying Therapeutic Discovery Project (QTDP) program ... than 250 employees. The Patient Protection and ...
Cached Biology Technology:Rensselaer Polytechnic Institute professor James Lu garners award for research on 3-D computer chips 2Intarcia Therapeutics Executive Chairman, Kurt Graves to Present at Lazard Capital Markets 7th Annual Healthcare Conference 2StemCyte Awarded $488,950 for Advanced Therapeutic Applications of Umbilical Cord Blood Stem Cells from the Qualifying Therapeutic Discovery Project (QTDP) 2
Agarose II (Low Melt)...
... antibody raised against a partial recombinant FES. ... 120 a.a. ~ 250 a.a) partial recombinant ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Accession Number: AAH35357 ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
Biology Products: