Navigation Links
Ethanol byproduct produces green results
Date:7/2/2008

her ornamentals and effectiveness of controlling other types of weeds.

Dried distillers grains are becoming more readily available as ethanol production in the U.S. increases. The push to produce ethanol, a cleaner-burning alternative to gasoline, has gained interest as gasoline prices continue to soar. As production increases, finding new uses for byproducts like DDGS becomes more critical. Dr. Boydston sees the results of this and similar ARS studies as a win/win for ethanol producers and the agriculture industry, noting, "identifying new uses for byproducts likes distillers grains could increase the profitability of ethanol production".


'/>"/>

Contact: Michael W. Neff
mwneff@ashs.org
703-836-4606
American Society for Horticultural Science
Source:Eurekalert  

Page: 1 2

Related biology news :

1. LSU professors work to improve efficiency of ethanol fuel
2. Increase in ethanol production from corn could significantly impact
3. Can plant-based ethanol save us from our fossil fuel addiction?
4. Trash today, ethanol tomorrow
5. US rush to produce corn-based ethanol will worsen dead zone in Gulf of Mexico: UBC study
6. Fueling ethanol production while protecting water quality
7. New study shows Dermytol produces pronounced decrease in malignant melanoma tumor volume
8. New chemotherapy combo produces side effects, but no extra efficacy, in early breast cancer patients
9. Green tea boosts production of detox enzymes, rendering cancerous chemicals harmless
10. New study shows greenback cutthroat trout involved in recovery effort misidentified
11. American Chemical Society calls green chemistry bill a smart step
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
Ethanol byproduct produces green results
(Date:5/19/2015)... Research and Markets ( ... the  "Genetic Testing Market Outlook 2018"  report ... ,A recent report, Genetic Testing Market Outlook ... current and future genetic testing market. A ... principles and types are covered in this ...
(Date:5/11/2015)... SAN JOSE, Calif. , May 11, 2015 ... leading developer of human interface solutions, today announced ... Senior Vice President and Chief Financial Officer, reporting ... Mr. Ali replaces Synaptics, current Chief Financial Officer, ... in December 2014. Mr. Ali ...
(Date:5/8/2015)... , May 8, 2015 Synaptics Inc. (NASDAQ: ... today announced that members of the executive management team will ... 43rd Annual Technology, Media and Telecom Conference Date: May ... in Boston, MA Cowen ... 2015 Time: 2:45pm ET Location: The New York Palace Hotel, ...
Breaking Biology News(10 mins):Global Genetic Testing Market Outlook 2018 2Synaptics Appoints Wajid Ali as Senior Vice President and Chief Financial Officer 2Synaptics to Present at Upcoming Investor Conferences 2
... science and technology has seen exciting advances recently ... According to international scientific conventions, nanomaterials are those ... or equal to 10-9 m. At the same ... to enter ecosystems at the points of use ...
... 2012 Individuals with mutations in BRCA1 and BRCA2 genes ... cancers. Families at risk have been seeking genetic testing ... standard method of direct sequencing is labor-intensive, costly, and it ... A group of Canadian scientists has developed a new ...
... study of North American songbirds reveals that birds that live ... up helps birds ensure that their songs are heard no ... and the National Evolutionary Synthesis Center. To test the ... male birds spanning 44 species of North American songbirds ...
Cached Biology News:Understanding the biological and ecological implications of safe nanotechnology 2New method provides fast, accurate, low cost analysis of BRCA gene mutations in breast cancer 2Birds that live with varying weather sing more versatile songs 2
(Date:5/22/2015)... 2015 Charm Sciences, Inc. is ... Agriculture (USDA), Grain Inspection, Packers and Stockyards Administration ... Charm Sciences to monitor aflatoxin in grains utilizing ... ROSA FAST Aflatoxin Quantitative Test (solvent-based). , The ... uses Water Extraction Technology to extract aflatoxin from ...
(Date:5/21/2015)... MO (PRWEB) May 21, 2015 Seventh ... the safety and efficacy of pharmaceutical products and medical ... Maryland Heights, MO 63043, a 50,000 sq. ft. building ... location, to enable strategic growth. Facility renovations will begin ... the new space will occur in September. , ...
(Date:5/21/2015)... May 21, 2015 uBiome, the ... a partnership with PicnicHealth, a healthcare company that ... diagnosed with Inflammatory Bowel Disease (IBD) will receive ... complementary uBiome research kit. Both companies were funded ... , For more information on this partnership ...
(Date:5/21/2015)... Bridgewater, NJ (PRWEB) May 21, 2015 ... and a method for diagnostic or therapeutic imaging within ... the apparatus uses an endoscope having a low cost, ... original USPTO filing date was October 18, 2013 and ... The technology enables the physician to customize the ...
Breaking Biology Technology:USDA-GIPSA (FGIS) Awards 5 Year Contract for Aflatoxin Tests to Charm Sciences 2Seventh Wave Laboratories Purchases Building for Expansion, Upcoming Move 2Seventh Wave Laboratories Purchases Building for Expansion, Upcoming Move 3uBiome Partners with PicnicHealth 2uBiome Partners with PicnicHealth 3IpAuctions™ Presents The Worlds Smallest Disposable Illuminated Endoscope For Auction 2IpAuctions™ Presents The Worlds Smallest Disposable Illuminated Endoscope For Auction 3
... Metavante Corp. , the banking and payments technology subsidiary ... the formation of a new cash-management division and the ... veteran Gary Kasik. , ,Kasik will run the division, ... manage investments, certain income statement items, payables, and receivables ...
... but I am an academic researcher at heart. I've also ... so I wear three sets of interchangeable glasses when assessing ... belly of the beast, I know too well the compromises ... door, but I am first and foremost a cognitive scientist ...
... - Adapting military research on hydrogen-powered refrigeration technology to ... more environmentally friendly, but only after they stop driving. ... rest, many leave their engines idling to regulate the ... diesel trucks on U.S. roads today, idling engines annually ...
Cached Biology Technology:Judging educational software 2Judging educational software 3Judging educational software 4Modine adapts military research to idling engines 2Modine adapts military research to idling engines 3
...
... is an evolutionarily conserved form of cell ... The central component of this process ... caspases. These enzymes participate in a ... response to pro-apoptotic signals and result in ...
... for high-yield protein expression ,The ... a high-yielding clone of Sf9 cells. Pre-adapted ... Cell Medium, these cells are recommended for ... baculovirus infection or transfection of appropriate vectors. ...
... Mouse monoclonal antibody raised against a partial ... (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant ... Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: ... AAH39825 OMIM: 154235, ...
Biology Products: