Navigation Links
Early human habitat was savanna, not forest
Date:5/27/2010

Pre-humans living in East Africa 4.4 million years ago inhabited savannas -- grassy plains dotted with trees and shrubs -- according to a team of researchers that includes earth science Naomi Levin of The Johns Hopkins University's Krieger School of Arts and Sciences.

This conclusion is at odds with a theory which holds that these early beings lived in a mostly forested environment put forth by prominent University of California at Berkeley researcher Tim D. White and his team in a 2009 issue of the journal Science.

"Our team examined the data published by White and his colleagues last October and found that their data does not support their conclusion that Ardipithecus ramidus lived exclusively in woodlands and forest patches," said Levin, whose team published a commentary on the matter in today's issue of Science. "The White team's papers stress the wooded nature of A. ramidus's environment and say specifically that Ardi did not live in a savanna. Yet, the actual data they present are consistent with exactly that: a savanna environment with a mix of grasses and trees."

This criticism is important because the claim that the 4.4 million-year-old fossil nicknamed "Ardi" lived in woodlands and forest patches was used as an argument against a longstanding theory of human evolution known as the "savanna hypothesis." According to that premise, the expansion of savannas grassy plains dotted with trees and shrubs prompted our ape-like forebears to descend from trees and begin walking upright to find food more efficiently, or to reach other trees for resources or shelter.

Levin, an assistant professor of earth and planetary sciences at Johns Hopkins, was part of a team of eight geologists and anthropologists from seven universities led by Thure E. Cerling of the University of Utah. They used the White team's own data to draw very different conclusion about the environment inhabited by Ardi, an omnivorous, a
'/>"/>

Contact: Lisa DeNike
Lde@jhu.edu
443-287-9960
Johns Hopkins University
Source:Eurekalert

Page: 1 2

Related biology news :

1. The making of a queen: Road to royalty begins early in paper wasps
2. NIH grants K-State researcher nearly $1.5 million to study antibiotic-resistant bacteria
3. Study finds protein that plays key role in early embryonic development
4. Federal report finds early births decline in most categories
5. First X-ray lasers early success brings approval for next-phase facility
6. Researchers find melanoma not caused by early UVA light exposure
7. A new biological explanation for sadness in early postpartum
8. UDs Zhuang wins NSF Early Career Award for research on how cells bypass damaged DNA
9. CNIC and Banco Santander set up research project on early cardiovascular risk factors
10. Early Earth absorbed more sunlight -- no extreme greenhouse needed to keep water wet
11. Traces of early Native Americans -- in sunflower genes
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/24/2014)... its launch in December 2014, the 1U™ app ... trying to remember their usernames and passwords through replacing the ... To assist people who have struggled to remember usernames and ... and focuses on redefining identity, announced today that it is ...
(Date:12/22/2014)... DUBLIN , Dec. 22, 2014 Research and ... the addition of the "The Global Watermarking ... http://photos.prnewswire.com/prnh/20130307/600769 ... global digital media watermarking and fingerprinting markets. Watermarking ...
(Date:12/19/2014)... , Dec. 18, 2014 Research and Markets ... "iPhone 5S Fingerprint Sensor - Apple/AuthenTec TMDR92 & ... http://photos.prnewswire.com/prnh/20130307/600769 ... introduced the fingerprint reading feature with the iPhone 5S. ...
Breaking Biology News(10 mins):1U Offers Best Solution to the Username / Password Dilemma: For FREE! 21U Offers Best Solution to the Username / Password Dilemma: For FREE! 3The Global Watermarking and Fingerprinting Markets 2iPhone 5S Fingerprint Sensor - Apple/AuthenTec TMDR92 & Sapphire - Technology Report 2
... in a group of heat-loving bacteria by researchers at ... light a fire under next-generation biofuel production. Scientists ... to break down complex plant material such as switchgrass ... make biofuels. Conventional processes involve the addition of commercially ...
... faded since the end of the Cold War, existing ... devastating global impacts. Researchers at the University of ... effects of a hypothetical nuclear war between India and ... in distant countries. The work, by Mutlu Ozdogan ...
... in our bodies. This process is driven by microtubule filaments ... so-called motor proteins in the cytosol can control their dynamics. ... of cell division. It is composed in large part of ... size, shape and mobility of a cell. In a new ...
Cached Biology News:BESC researchers tap into genetic reservoir of heat-loving bacteria 2War-related climate change would reduce substantially reduce crop yields 2
(Date:1/22/2015)... 2015 Protocol Networks brings independent technology ... of brand-neutral, independent consultants, Protocol Networks has recently announced ... over the years, his company has attracted several clients ... Plainfield, as well as others. With the success of ...
(Date:1/22/2015)... Pipette.com has added the Eppendorf ... portfolio of Eppendorf products. , The Eppendorf Centrifuge 5424/5424 ... 5424/5424 R and receive the following:, , ... or Eppendorf Reference 2 ,     3 Free ...
(Date:1/22/2015)... Madison, WI (PRWEB) January 22, 2015 Dr. ... at the 12th annual Scripps Natural Supplements Pre-Conference seminar on ... Supplements Conference is an annual continuing education conference for health ... 15th and included the topic of probiotics in health. Dr. ...
(Date:1/22/2015)... January 22, 2015 Selexis SA, a ... Research Cell Banks (RCBs) used for drug discovery to ... Banks will include Next-Generation Sequencing (NGS) data ... de-risks biologic manufacturing by ensuring the integrity of the ...
Breaking Biology Technology:Protocol Networks Brings Independent Technology Consulting to the Constitution State 2Eppendorf Announces Promotional Bundle Which Includes: Eppendorf Centrifuge 5424, 3-Pack of Pipettes, and Tips - Available Now at Pipette.com 2Selexis Generated Research Cell Banks Now Fully Sequenced Using Next-Generation Sequencing 2
... AUSTIN, Texas and TORONTO, Oct. 3 Two ... to integrate vibration,therapy into the stem cell harvesting ... company based in Austin,Texas, has signed an exclusive ... of Toronto, Ontario. The partnership,between the two companies ...
... ),AMDL, Inc. (Amex: ADL ), a leading vertically ... US, today announced that the,Company will present at the ... Tuesday, October 7, 2008 at 10:30 a.m. ET. AMDL,s ... Hotel in the Morosco Room., The Maxim Group ...
... Stock Exchange Symbol: MS, EDMONTON, Oct. 3 ... developer in the treatment of multiple sclerosis (MS), ... (DSMB) for the,Company,s U.S. pivotal phase III MAESTRO-03 ... MS has completed a safety analysis,and recommended that ...
Cached Biology Technology:New Partnership Integrates Vibration Therapy Into Stem Cell Procedures 2New Partnership Integrates Vibration Therapy Into Stem Cell Procedures 3AMDL, Inc. to Present at Maxim Group Growth Conference October 7, 2008 2AMDL, Inc. to Present at Maxim Group Growth Conference October 7, 2008 3BioMS Medical's phase III U.S. multiple sclerosis trial receives positive safety review from Data Safety Monitoring Board 2
... for high-yield protein expression ,The ... a high-yielding clone of Sf9 cells. Pre-adapted ... Cell Medium, these cells are recommended for ... baculovirus infection or transfection of appropriate vectors. ...
... Mouse monoclonal antibody raised against a partial recombinant ... 358 a.a. ~ 457 a.a) partial recombinant protein ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Mouse monoclonal antibody raised against a partial recombinant QARS. NCBI Entrez Gene ID = QARS...
Biology Products: