Navigation Links
Durham scientists to tackle CO2 storage in global warming challenge
Date:7/23/2008

ES, at Durham University, said: "As demand for energy increases we need innovative and practical solutions where CO2 can be removed from the atmosphere to counteract global warming.

"Our combined expertise will allow us to investigate ways of capturing carbon and ensuring that it remains underground once stored."

DONG Energy will lend its experience in producing and distributing energy while Ikon Science will develop new technologies for monitoring and modelling the injection of CO2 into the earth.

Martyn Millwood Hargrave, Chief Executive of UK headquartered Subsurface Technology developer Ikon Science, said: "We look forward to working with the highly respected CeREES team in Durham to accelerate the development and take up of new technologies and methods including integration with our proven RokDoc subsurface modelling system."

Brent Cheshire, Managing Director of DONG Energy (UK) Ltd, said: "We are delighted to be working together with Durham University and Ikon in this very important area and to build on the position we have already established in the UK both in renewable energy and West of Shetland hydrocarbon exploration."

Margaret Fay, Chairman of Regional Development Agency One NorthEast, said: "Reducing the amount of CO2 released into the atmosphere is possibly the single most important issue facing the world today.

"This announcement is further evidence of North East England's excellent reputation for research in the field of green energy. Global companies recognise that the region is fast becoming a hub for new and renewable energy research and development."


'/>"/>

Contact: Alex Thomas
media.relations@durham.ac.uk
44-019-133-46075
Durham University
Source:Eurekalert

Page: 1 2

Related biology news :

1. Licking your wounds: Scientists isolate compound in human saliva that speeds wound healing
2. Training future scientists at the Ecological Society of Americas 93rd Annual Meeting
3. Gladstone scientists create Wikipathways to foster research collaboration
4. Nature publishes new evidence about the deep biosphere written by biogeoscientists
5. ASBMB taps 8 scientists for top awards
6. When fish talk, scientists listen
7. Scientists demonstrate the sharpest measurement of ice crystals in clouds
8. Scientists demonstrate means of reducing Alzheimers-like plaques in fly brain
9. Scientists discover key patterns in the packaging of genes
10. Scripps research scientists reveal key structure from ebola virus
11. Scientists learn how food affects the brain
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/24/2014)... its launch in December 2014, the 1U™ app ... trying to remember their usernames and passwords through replacing the ... To assist people who have struggled to remember usernames and ... and focuses on redefining identity, announced today that it is ...
(Date:12/22/2014)... DUBLIN , Dec. 22, 2014 Research and ... the addition of the "The Global Watermarking ... http://photos.prnewswire.com/prnh/20130307/600769 ... global digital media watermarking and fingerprinting markets. Watermarking ...
(Date:12/19/2014)... , Dec. 18, 2014 Research and Markets ... "iPhone 5S Fingerprint Sensor - Apple/AuthenTec TMDR92 & ... http://photos.prnewswire.com/prnh/20130307/600769 ... introduced the fingerprint reading feature with the iPhone 5S. ...
Breaking Biology News(10 mins):1U Offers Best Solution to the Username / Password Dilemma: For FREE! 21U Offers Best Solution to the Username / Password Dilemma: For FREE! 3The Global Watermarking and Fingerprinting Markets 2iPhone 5S Fingerprint Sensor - Apple/AuthenTec TMDR92 & Sapphire - Technology Report 2
... in a group of heat-loving bacteria by researchers at ... light a fire under next-generation biofuel production. Scientists ... to break down complex plant material such as switchgrass ... make biofuels. Conventional processes involve the addition of commercially ...
... faded since the end of the Cold War, existing ... devastating global impacts. Researchers at the University of ... effects of a hypothetical nuclear war between India and ... in distant countries. The work, by Mutlu Ozdogan ...
... in our bodies. This process is driven by microtubule filaments ... so-called motor proteins in the cytosol can control their dynamics. ... of cell division. It is composed in large part of ... size, shape and mobility of a cell. In a new ...
Cached Biology News:BESC researchers tap into genetic reservoir of heat-loving bacteria 2War-related climate change would reduce substantially reduce crop yields 2
(Date:1/22/2015)... 2015 Protocol Networks brings independent technology ... of brand-neutral, independent consultants, Protocol Networks has recently announced ... over the years, his company has attracted several clients ... Plainfield, as well as others. With the success of ...
(Date:1/22/2015)... Pipette.com has added the Eppendorf ... portfolio of Eppendorf products. , The Eppendorf Centrifuge 5424/5424 ... 5424/5424 R and receive the following:, , ... or Eppendorf Reference 2 ,     3 Free ...
(Date:1/22/2015)... Madison, WI (PRWEB) January 22, 2015 Dr. ... at the 12th annual Scripps Natural Supplements Pre-Conference seminar on ... Supplements Conference is an annual continuing education conference for health ... 15th and included the topic of probiotics in health. Dr. ...
(Date:1/22/2015)... January 22, 2015 Selexis SA, a ... Research Cell Banks (RCBs) used for drug discovery to ... Banks will include Next-Generation Sequencing (NGS) data ... de-risks biologic manufacturing by ensuring the integrity of the ...
Breaking Biology Technology:Protocol Networks Brings Independent Technology Consulting to the Constitution State 2Eppendorf Announces Promotional Bundle Which Includes: Eppendorf Centrifuge 5424, 3-Pack of Pipettes, and Tips - Available Now at Pipette.com 2Selexis Generated Research Cell Banks Now Fully Sequenced Using Next-Generation Sequencing 2
... AUSTIN, Texas and TORONTO, Oct. 3 Two ... to integrate vibration,therapy into the stem cell harvesting ... company based in Austin,Texas, has signed an exclusive ... of Toronto, Ontario. The partnership,between the two companies ...
... ),AMDL, Inc. (Amex: ADL ), a leading vertically ... US, today announced that the,Company will present at the ... Tuesday, October 7, 2008 at 10:30 a.m. ET. AMDL,s ... Hotel in the Morosco Room., The Maxim Group ...
... Stock Exchange Symbol: MS, EDMONTON, Oct. 3 ... developer in the treatment of multiple sclerosis (MS), ... (DSMB) for the,Company,s U.S. pivotal phase III MAESTRO-03 ... MS has completed a safety analysis,and recommended that ...
Cached Biology Technology:New Partnership Integrates Vibration Therapy Into Stem Cell Procedures 2New Partnership Integrates Vibration Therapy Into Stem Cell Procedures 3AMDL, Inc. to Present at Maxim Group Growth Conference October 7, 2008 2AMDL, Inc. to Present at Maxim Group Growth Conference October 7, 2008 3BioMS Medical's phase III U.S. multiple sclerosis trial receives positive safety review from Data Safety Monitoring Board 2
... for high-yield protein expression ,The ... a high-yielding clone of Sf9 cells. Pre-adapted ... Cell Medium, these cells are recommended for ... baculovirus infection or transfection of appropriate vectors. ...
... Mouse monoclonal antibody raised against a partial recombinant ... 358 a.a. ~ 457 a.a) partial recombinant protein ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Mouse monoclonal antibody raised against a partial recombinant QARS. NCBI Entrez Gene ID = QARS...
Biology Products: