Navigation Links
Duke and the Internationalserious Adverse Event Consortium to partner on research
Date:1/27/2010

Chicago (January 27, 2009) The International Serious Adverse Events Consortium (SAEC) announced today it will collaborate with Duke University's Center for Human Genome Variation (http://www.genomics.duke.edu/centers/pg2/ ) to research the genetics of Clozapine-induced agranulocytosis (CIA), with the goal of identifying potential rare genetic variants predictive of this serious drug induced adverse event. The SAEC is a novel, non-profit international research consortium, formed by the global pharmaceutical industry, to better understand the role of genetics in drug safety. Duke University's Center for Human Genome Variation, under the leadership of David Goldstein, PhD and Professor of Molecular Genetics & Microbiology, applies state-of-the-art genomic science to help understand how human genetic variation influences disease and drug response. Dr. Anna Need, of Duke's Department of Psychiatry will jointly manage the collaborative research.

Clozapine is an atypical antipsychotic agent used extensively in the treatment of schizophrenia patients. An important factor limiting its use is the risk of potentially fatal agranulocytosis, estimated in less than 2 percent of treated patients. Agranulocytosis is the failure of the bone marrow to produce enough white blood cells (neutrophils) resulting in a significantly reduced immune response. Clozapine is made available through a special FDA sanctioned special surveillance system (Clozapine Patient Management System). Under this program, patients must have a weekly white-cell count to receive their supply of the drug.

Last fall, the SAEC received as a gift, the research materials and data relating to the CIA cohort to be used in the collaboration from PGx Health (http://www.pgxhealth.com/), a division of Clinical Data, Inc. These data corroborated the already published evidence for genetic associations
'/>"/>

Contact: Arthur L. Holden
773-867-8595
Zeno Group
Source:Eurekalert

Page: 1 2

Related biology news :

1. Faster koa tree growth without adverse ecosystem effects
2. Herceptin and chemo improves response rates without major adverse effects in HER2 breast cancer
3. Medicines derived from cannabis: a review of adverse events
4. International Serious Adverse Events Consortium announces initial study results in its global research collaboration to identify genetic markers related to drug induced liver injury
5. Complications early in pregnancy or in previous pregnancies adversely affect existing or subsequent pregnancies
6. Controlling for size may also prevent cancer
7. Avocados may help prevent oral cancer, OSU study shows
8. Dietary calcium could possibly prevent the spread of breast cancer to bone
9. Bilberry extract -- can it help prevent certain cancers?
10. Preventing tuberculosis reactivation
11. NIH hosts event to launch Council of Science Editors global theme issue
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/16/2014)... to make ethical choices such as buying clothing not ... fair-trade coffee, and bringing their own bags when they ... Journal of Consumer Research , ethical consumption is ... emotions about unethical practices into action. , "Advocates of ... and human costs of the products they choose, but ...
(Date:9/16/2014)... practically all vital functions in an organism. For ... particular substances and control immune system responses. Researchers ... function independently of each other, but instead form ... networks, you find many similarities with online social ... of Plant Systems Biology. "Some proteins are good ...
(Date:9/16/2014)... , Sept. 16, 2014  Cross Match Technologies, ... solutions, announced today the launch of its Verifier ... the identity of an individual using their secure ... Sentry rapidly reads credential documents with embedded biometric ... matching the biometric to a live scan of ...
Breaking Biology News(10 mins):Why are consumers willing to spend more money on ethical products? 2Good networkers make prime targets 2Cross Match Launches New Identity Management Handheld Solution 2
... Children's Hospital of Philadelphia leads a multi-center $6.7 million ... of Mental Health (NIMH) to explore a novel approach ... studies and clinical trials in adult patients, the new ... human immunodeficiency virus: sites on immune cells known as ...
... found Envisat's MERIS sensor can detect coral bleaching ... could potentially monitor impacted coral reefs worldwide on ... symbiotic algae living in symbiosis with living coral ... expelled. The whitening coral may die with subsequent ...
... what happens in cells is the work of machines that ... human and other genomes, researchers now have a nearly complete ... manual telling where all the pieces go. A new study ... to answer this question for some of the smallest and ...
Cached Biology News:Federal grant funds research on novel HIV therapy 2Federal grant funds research on novel HIV therapy 3Health of coral reefs detected from orbit 2Many needles, many haystacks 2
(Date:9/16/2014)... Valley, Arizona (PRWEB) September 16, 2014 ... that develops safe and effective products to treat ... the use of a proprietary SPACEā„¢ Technology Platform ... Officer and President will present at the White ... 2014 at the Hyatt Regency Phoenix. In ...
(Date:9/16/2014)... , Sept. 16, 2014  Ascendis Pharma ... TransCon technology to address significant unmet medical needs, ... Phase 2 pediatric study to evaluate once-weekly TransCon ... or GHD.  The full interim results will be ... GRS and IGF Society, being held October 15-18, ...
(Date:9/16/2014)... According to Jeff Howell, Partner of Nidea ... new development in Downtown Toronto is expanding at a ... 755 storeys of new development last week (including three ... dominating the Toronto skyline for the foreseeable future in ... for new development. , As the Toronto city council ...
(Date:9/15/2014)... GREENBELT, Md. , Sept. 15, 2014 /PRNewswire/ ... a leading innovator of scientific products and services ... government-wide One Acquisition Solution for Integrated Services (OASIS) ... Service (FAS). GST was selected to provide the ... in the Small Business (SB) category in Pool ...
Breaking Biology Technology:Convoy Therapeutics to Present at WhiteHat Investor Conference September 18, 2014 2Convoy Therapeutics to Present at WhiteHat Investor Conference September 18, 2014 3Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 2Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 3Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 4ITRA Global Reports Downtown Toronto Real Estate Development is in High Gear 2ITRA Global Reports Downtown Toronto Real Estate Development is in High Gear 3Global Science & Technology, Inc. Awarded GSA OASIS Small Business Contract 2Global Science & Technology, Inc. Awarded GSA OASIS Small Business Contract 3
... HUBBARD, Ohio, Sept. 24 /PRNewswire-Firstcall/ -- NanoLogix, Inc. ... an exhibitor and,participant in the "Energy from Biomass ... David L. Lawrence Convention,Center in Pittsburgh, Pennsylvania September ... NanoLogix booth at the Expo, with,Dana Allen, Bret ...
... Seasoned leader brings added expertise to Shire ... England, Sept. 24, Shire plc (LSE: SHP, ... company, announced today that Sylvie,Gregoire has been ... (HGT),business, effective immediately. Sylvie brings more than ...
... BioCryst,Pharmaceuticals, Inc. (Nasdaq: BCRX ) today ... Life Sciences Conference in New York. A live ... 2007 at 2:00 p.m. Eastern,Time may be accessed ... will be archived for seven days. (Logo: ...
Cached Biology Technology:NanoLogix Inc. to Present at EBW Expo & Conference 2007 2Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 2Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 3Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 4BioCryst to Present at UBS 2007 Global Life Sciences Conference 2BioCryst to Present at UBS 2007 Global Life Sciences Conference 3
... Knockout System provides optimized reagents and protocols ... bacterial genes by insertion of group II ... of group II introns and utilizes a ... group II intron for specific insertion into ...
... monoclonal antibody raised against a partial recombinant MAK. ... a.a. ~ 457 a.a) partial recombinant protein with ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Biology Products: