Navigation Links
Despite countless changes, original HIV infection lurks within
Date:6/29/2010

Scientists have been surprised to learn that, despite thousands of changes that viruses like HIV undergo in rapid fashion to evade the body's immune system, the original version that caused the infection is still present in the body months later.

The finding, published in the June issue of the Journal of Virology, is the result of an uncommonly detailed look at the cat-and-mouse action that takes place in an organism shortly after infection. The work is aimed at understanding the earliest stages of infection by HIV more thoroughly, to help scientists develop ways either to quash the infection outright or to develop a vaccine to prevent infection.

The research, which was conducted by scientists at the University of Rochester Medical Center, is based on an analysis of more than 100,000 genetic snippets of a virus known as SIV, or simian immunodeficiency virus, which infects monkeys and is a close cousin of HIV.

While HIV has flummoxed scientists for nearly three decades, that's certainly not because our immune system fails to respond. Rather, within two or three weeks of infection, the onslaught of immune cells puts the virus on the run to such an extent that the virus must mutate rapidly to evade the body's defenses.

HIV changes quickly and continually, creating thousands and thousands of mutated versions of itself in a process called "viral escape." The virus changes; the immune cells hunting it down change in response; and the virus changes again, and so on, in a kind of molecular arms race.

"Viral escape is a significant phenomenon in HIV it's what allows HIV to elude the immune system," said Ha Youn Lee, Ph.D., the assistant professor in the Department of Biostatistics and Computational Biology who led the project.

"The dynamics in the earliest stage of infection by HIV are incredibly complex, and understanding what happens is crucial for developing a vaccine," Lee added.

To do the study
'/>"/>

Contact: Tom Rickey
tom_rickey@urmc.rochester.edu
585-275-7954
University of Rochester Medical Center
Source:Eurekalert

Page: 1 2 3

Related biology news :

1. Pesky aphid thrives despite weak immune system
2. Despite risk, older African-Americans more likely than others to avoid flu vaccine
3. Despite claims, UK did not gas Iraqis in the 1920s, new research finds
4. Birds in Flint Hills of Kansas, Oklahoma face population decline despite large habitat
5. Organic soils continue to acidify despite reduction in acidic deposition
6. Despite peacenik reputation, bonobos hunt and eat other primates too
7. Despite awareness of global warming Americans concerned more about local environment
8. CITES caviar export quotas remain steady for beluga sturgeon despite threat of extinction
9. River delta areas can provide clue to environmental changes, Texas A&M prof says
10. River delta areas can provide clue to environmental changes, Texas A&M prof says
11. Aboriginal hunting and burning increase Australias desert biodiversity, Stanford researchers find
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/23/2014)... the development of animals and plants. The central problem ... translated in a reliable manner to give specific spatial ... of stripe formation is a classic paradigm in developmental ... the French flag, is caused by a gradient of ... low concentrations of the morphogen a "blue", "white" or ...
(Date:9/23/2014)... SPRINGS, Florida , September 23, 2014 ... for innovative companies in tech sector position for significant investor ... products & services.  Companies in focus today are: NXT-ID, Inc. ... BABA ), Mobileye N.V. (NYSE: MBLY ... Robotics Ltd. (NASDAQ: RWLK) NXT-ID, Inc. (NASDAQ: ...
(Date:9/22/2014)... Many native species have vanished from tropical islands ... scientists have discovered how fossils can be used ... lies in organic materials found in fossil bones, ... according to a new study available online and ... of Herpetology . Pre-human island ecosystems provide vital ...
Breaking Biology News(10 mins):Recreating the stripe patterns found in animals by engineering synthetic gene networks 2Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 2Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 3Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 4Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 5Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 6Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 7Answer to restoring lost island biodiversity found in fossils 2
... , HERNDON, Va., Dec. 15 The PTR ... announced that it has agreed to sponsor three high school teams ... http://usfirst.org ). , The PTR Group will provide funding ... teams from Atholton HS in Columbia, MD, Rockwall HS in Rockwall, ...
... often promoted as a clean-burning, renewable fuel that could help ... caused by ozone, compared with gasoline, especially in winter, according ... Ozone production from both gasoline and E85, a blend of ... in warm sunny weather than during the cold weather and ...
... 10, 2009If you are spending the holidays with big Uncle ... be better off with another family, spare a thought for ... McMaster University and the University of New South Wales has ... members make strategic decisions about their living situation. ...
Cached Biology News:The PTR Group Announces Financial and Technical Support to US FIRST Robotics Competition Teams 2Ethanol-powered vehicles generate more ozone than gas-powered ones 2Ethanol-powered vehicles generate more ozone than gas-powered ones 3
(Date:9/23/2014)... 23, 2014 Texas Fertility Center (TFC) ... South Austin, expanding a Central Texas footprint that includes ... The satellite office for the region’s most established practice ... the South Austin, Buda, Kyle and San Marcos communities. ... fertility treatment directly to individuals and couples living in ...
(Date:9/23/2014)... (PRWEB) September 23, 2014 The ... a developer of cellular modems , platforms ... in the Startup category for the 2014 Tekne ... held at the Minneapolis Convention Center on Thursday, ... and individuals who have shown superior technology innovation ...
(Date:9/22/2014)... YORK and SANTA CLARA, Calif. ... Corp. (NASDAQ: WBMD ), the leading source ... new WebMD/Medscape survey that provide novel insights ... in aiding diagnosis and care.  Dr. Eric Topol ... and digital medicine, who serves as both Editor-in-Chief of ...
(Date:9/22/2014)... in a mouse model of pancreatic cancer identified distinct ... including significant differences from the primary tumor that may ... their study reported in the Sept. 25 issue of ... Hospital (MGH) Cancer Center identified several different classes of ... to be targets for improved treatment of the deadly ...
Breaking Biology Technology:Opening Doors to a Family: Texas Fertility Center Announces Newest Fertility Clinic in South Austin 2Opening Doors to a Family: Texas Fertility Center Announces Newest Fertility Clinic in South Austin 3NimbeLink Named Finalist for 15th Annual Tekne Awards 2NimbeLink Named Finalist for 15th Annual Tekne Awards 3WebMD/Medscape Digital Technology Survey Reveals Unique Insights Into How Patients and Physicians Perceive the Role, Potential and Risks Associated with Digital Health Technologies 2WebMD/Medscape Digital Technology Survey Reveals Unique Insights Into How Patients and Physicians Perceive the Role, Potential and Risks Associated with Digital Health Technologies 3WebMD/Medscape Digital Technology Survey Reveals Unique Insights Into How Patients and Physicians Perceive the Role, Potential and Risks Associated with Digital Health Technologies 4Massachusetts General study reveals gene expression patterns in pancreatic CTCs 2Massachusetts General study reveals gene expression patterns in pancreatic CTCs 3
... (NASDAQ: NEOG ) announces the following Webcast:What: ... 26, 2011 @ 11:00 ETWhere: , http://www.videonewswire.com/event.asp?id=80894 How: ... on to the web at the address above.  Contact: ... are unable to participate during the live webcast, the ...
... ,   Elsevier, a ... services, today announced the,highlights of its journal Impact Factor ... ® ,published by Thomson Reuters, Elsevier saw over 55% ... while slightly over 49%,of non-Elsevier journals showed an increased ...
... ,   Executives from O2h ... agreement to substantially,increase the number of FTE chemists provided by ... Congreve, Head of Chemistry at Heptares said, "O2h has,been a ... our synthetic chemistry team to include a full lab unit ...
Cached Biology Technology:Elsevier Announces 2010 Journal Impact Factor Highlights 2Elsevier Announces 2010 Journal Impact Factor Highlights 3Oxygen Healthcare (O2h) Announces Expanded Chemistry Collaboration With Heptares Therapeutics 2
Mouse monoclonal antibody raised against a partial recombinant DENR. NCBI Entrez Gene ID = DENR...
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
... Mouse polyclonal antibody raised against a partial ... FES (AAH35357, 120 a.a. ~ 250 a.a) ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: