Navigation Links
Debris flows, landslides, fossil microatolls, paleo-seasonality, and carbonate ore deposits
Date:8/2/2012

nd related degrading permafrost areas -- a zone where debris flows are quite frequently initiated. This study by F. Kober and colleagues investigates the impact of episodic debris flows on catchment-wide denudation rates in alpine catchments obtained with cosmogenic nuclides. This method is convenient in establishing alpine denudation rates over larger areas and offers the opportunity of quantifying and charactering mountain range erosion and its driving forces (e.g., by climate, glacial history, or tectonics). This method also assumes that episodic events are balanced spatially and over the time the erosion rate is established. The result of this study shows for the Aare catchment (Switzerland), localized debris flows events can significantly perturb cosmogenic denudation rates by a factor of two. Kober and colleagues also suggest that only events with a large magnitude (and commonly with a low frequency) events perturb the system, if they are additionally coupled with the trunk stream.


Mid-Pacific microatolls record sea-level stability over the past 5000 yr

Colin D. Woodroffe et al., School of Earth and Environmental Sciences, University of Wollongong, NSW 2522, Australia. Posted online 1 August 2012; doi: 10.1130/G33344.1.

Radiometric dating of fossil corals and accurate survey of their elevations on Christmas Island in the central Pacific provides a record of sea level over the past 5000 years. Corals that grow into the intertidal zone adopt a "microatoll" form that is dead on top but can grow laterally to several meters in diameter. These are one of the more accurate indicators of sea-level change because their upper surface is constrained by low tide and growth around their perimeters responds quickly to rising or falling sea levels. Comparison of the height of many fossil microatolls with the elevation to which living counterparts grow implies that sea level has remained close to its present level (plus or minus 20 to
'/>"/>

Contact: Kea Giles
kgiles@geosociety.org
Geological Society of America
Source:Eurekalert

Page: 1 2 3 4 5 6 7 8

Related biology news :

1. Seismic zones, river deltas, landslides, fossil reptiles, and more new Geology science
2. Protecting living fossil trees
3. Dinosaur fossil: Even specialized predators didnt turn down free meals
4. Buy coal? New analysis shows purchasing fossil fuel deposits best way to fight climate change
5. Anthropologist finds explanation for hominin brain evolution in famous fossil
6. Ancient giant turtle fossil revealed
7. Scientists find gold-plated fossil solution
8. Human-like spine morphology found in aquatic eel fossil
9. Work starts on fossil fuel free cargo ship set to transform shipping industry
10. Fossil turtle from Colombia round like car tire
11. Fossil egg discovered in Lleida (Spain) links dinosaurs to modern birds
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/23/2015)... , June 23, 2015   MedNet Solutions ... supports the entire spectrum of clinical research, is ... ™ , the company,s intuitive, flexible and ... a Silver 2015 Stevie® Award by the ... & Services Website category.  The American Business Awards ...
(Date:6/23/2015)... June 23, 2015  Crossmatch™, a leading ... today announced enhanced functionality of its DigitalPersona ... The enhancements build on the native flexibility ... Altus platform and provide expanded mobile credential ... In today,s environment of increasing cyber-attacks and ...
(Date:6/17/2015)... GERMANTOWN, Maryland , June 17, 2015 ...   Produktlinie mit DNA-Tests verbessert den Analyseprozess und ... QGEN ; Frankfurt Prime Standard: QIA) hat heute in ... Produktlinie Investigator ® für ... Die neuen Kits zur Erstellung genetischer Fingerabdrücke bieten eine ...
Breaking Biology News(10 mins):MedNet Solutions' iMedNet eClinical Wins Silver Stevie Award 2Crossmatch Releases Enhanced DigitalPersona Altus Advanced Authentication Functionality 2QIAGEN bringt in den USA neue Kits für die forensische DNA-Analyse auf den Markt 2QIAGEN bringt in den USA neue Kits für die forensische DNA-Analyse auf den Markt 3QIAGEN bringt in den USA neue Kits für die forensische DNA-Analyse auf den Markt 4QIAGEN bringt in den USA neue Kits für die forensische DNA-Analyse auf den Markt 5QIAGEN bringt in den USA neue Kits für die forensische DNA-Analyse auf den Markt 6
... A study at the University of Leeds has shown, ... and swim using the same gait, overturning the widely ... The findings have important implications for biologists and ... Until recently scientists have largely limited their observations of ...
... Saenz, MD, a Medical Genetics Fellow at The Children,s ... recipient of the Genzyme/American College of Medical Genetics Foundation ... ACMG 2009 Annual Clinical Genetics Meeting in Tampa, FL. ... support a national fellowship program to encourage the recruitment ...
... of Medical Genetics Foundation (ACMGF) recently awarded Dr. Sihoun ... Washington School of Medicine the 2009-2010 Luminex/ACMGF Award at ... Genetics Meeting in Tampa, FL. The award includes ... of safe and effective genetic testing and services, including ...
Cached Biology News:To swim or to crawl: For the worm it's a no brainer 2
(Date:7/2/2015)... 2, 2015  Spherix Incorporated (Nasdaq: SPEX ) -- an ... monetization of intellectual property, today announced a litigation update. ... v. Verizon Services Corp. et al. , Case No. ... Eastern District of Virginia , the ... interpreting certain key claims in favor of the Defendants ...
(Date:7/1/2015)... ... July 01, 2015 , ... It is now possible ... using single photon emission computed tomography (SPECT) according to researchers from Amen ... examined over 20,000 brain scans and is believed to be the largest brain imaging ...
(Date:7/1/2015)... AURORA, Colo. and BANGALORE, India ... a global genomic profiling company that uses next generation ... appointment of Scott A. Storrer as chief ... and CEO, he will be responsible for all strategy, ... Vijay Chandru , who has served as Strand,s chairman ...
(Date:7/1/2015)... ... July 01, 2015 , ... A newly launched business plan contest ... the barriers to innovation in life sciences R&D. The Pistoia Alliance President’s Startup Challenge ... of US$15,000 and a period of expert mentorship from a senior industry figure drawn ...
Breaking Biology Technology:Spherix Issues A Litigation Update 2Spherix Issues A Litigation Update 3Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 2Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 3Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 4Strand Life Sciences Names Scott A. Storrer CEO as Company Continues Global Expansion with Focus on Precision Medicine Product 2Strand Life Sciences Names Scott A. Storrer CEO as Company Continues Global Expansion with Focus on Precision Medicine Product 3Pistoia Alliance Launches Startup Challenge 2Pistoia Alliance Launches Startup Challenge 3
... Ph.D., President, ViaGen, January 11, 2008, WASHINGTON, ... Authority,s strong endorsement of the safety of food,from clones ... Drug,Administration to release its final risk assessment at the ... international,scientific consensus is clear: food from these animals and ...
... Energy now lost as heat during the production ... of silicon nanowires synthesized via a technique developed ... (DOE) Lawrence Berkeley National Laboratory (Berkeley Lab) and ... far-ranging potential applications of this technology include DOEs ...
... HealthCare Technologies,Ltd., (the "Company") today announced that it ... Staff of the Listing Qualifications Department,(the "Staff Determination") ... because the Staff believes that the Company,s Plan ... December 31, 2007, constituted a,reverse merger, the surviving ...
Cached Biology Technology:Statement on the Release of the European Food Safety Assessment on the Safety of Food Derived From Clones and Their Offspring in the Food Supply 2Feeling the heat 2Feeling the heat 3Feeling the heat 4HealthCare Technologies Ltd. (NASDAQ: HCTL) Announces Receipt of NASDAQ Delisting Notice 2
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
... antibody raised against a partial ... Immunogen: PPP4C (NP_002711, 218 ... recombinant protein with GST tag. ... NM_002720 ...
Biology Products: