Navigation Links
DHS Science and Technology Directorate's science conference: 'Catastrophes and Complex Systems'
Date:2/24/2011

The DHS Science and Technology Directorate's Fifth Annual University Summit will be held at the Washington DC Renaissance Hotel March 30-April 1 2011. This event is DHS's flagship research meeting and is well attended by university scientists, government officials and industry.

The Summit will connect university scientists working on DHS high-priority research areas with DHS components, industry, first responders, state/local officials, lawmakers, and policymakers.

Attendance is free, but registration is required. To register, go to the Summit website at http://www.orau.gov/dhssummit/.

Approximately 1,000 attendees are anticipated. The event is open to the media.

This year's event is titled "Catastrophes and Complex Systems: Transportation." It will focus on research and development solutions that address:

  • The security of complex transportation systems and their connecting infrastructure; and
  • Ways in which these systems can best be leveraged in mitigating, responding, and recovering from disasters.

During the Summit, competitively selected researchers from around the world will take part in interactive panel sessions to address homeland security challenges. Researchers and directors from the DHS Centers of Excellence (COEs), DHS program managers, subject matter experts, and other attendees will participate in the panel sessions to reveal solutions to homeland security challenges and help shape future university-based homeland security R&D.

Confirmed speakers include DHS leadership, S&T leadership and world-renowned terrorism experts from outside the United States.

Confirmed Speakers Include:

  • Under Secretary Tara O'Toole;
  • DHS Secretary Janet Napolitano;
  • TSA Administrator John Pistole;
  • NFL Director of Strategic Security Jeff Miller;
  • Professor Boaz Ganor, Executive Director of the Inter
    '/>"/>

Contact: John Verrico
john.verrico@dhs.gov
202-254-2385
US Department of Homeland Security - Science and Technology
Source:Eurekalert

Page: 1 2 3 4

Related biology news :

1. Vilcek Foundation names recipients of 2011 Vilcek Prizes in Biomedical Science
2. New bird to science emphasizes the critical need to conserve the remaining dry forests of Madagascar
3. Selected journals in Springers Chinese Library of Science join SpringerOpen
4. Planetary exploration robots to be featured on science program WaveLengths
5. Crossing borders in language science: What bilinguals tell us about mind and brain
6. 2011 FEBS/EMBO Women in Science Award honors Carol V. Robinson
7. Immunologist J. John Cohen receives the 2010 AAAS Public Understanding of Science and Technology Award
8. Joshua E. Neimark Memorial Travel Assistance Award winners investigate stem cell transplantation, sustainable growth, women in academia, and conservation science
9. Society for Neuroscience awarded $1.53 million to create BrainFacts.org
10. Chemical engineer earns National Science Foundation CAREER award for work with graphene quantum dots
11. Louisiana Tech University professor named a 2011 Environmental Health Sciences Fellow
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/17/2015)... Maryland , and HILDEN, Germany , ... QGEN ; Frankfurt Prime Standard: QIA) today launched new ... evidence in forensic laboratories in the United States ... solution to simultaneously analyze multiple key genomic markers (short tandem ... ® Quality Sensor to evaluate the quality of DNA ...
(Date:6/17/2015)... GARDENS, Fla. , June 17, 2015 /PRNewswire/ ... solutions, today announced that its U.are.U ® ... Togo,s Eateries, Inc., a ... casual sandwich chain, to increase security, improve accountability ... fingerprint readers enable instant, non-repudiable identity confirmation for ...
(Date:6/16/2015)... NEW YORK , June 16, 2015  With ... the world, security remains a top concern. The recent ... confirms the need for strong authentication within government ... HYPR Token, a biometric one-time password (OTP) authenticator, has ... Processing Standards (FIPS) 140-2 Level 3 validation for tamper ...
Breaking Biology News(10 mins):QIAGEN Launches New Genetic Fingerprinting Kits for U.S. Forensic Labs 2QIAGEN Launches New Genetic Fingerprinting Kits for U.S. Forensic Labs 3QIAGEN Launches New Genetic Fingerprinting Kits for U.S. Forensic Labs 4QIAGEN Launches New Genetic Fingerprinting Kits for U.S. Forensic Labs 5Togo's Eateries Improve Security and Accountability with Crossmatch Fingerprint Readers 2Togo's Eateries Improve Security and Accountability with Crossmatch Fingerprint Readers 3Government Ready Biometric Security Approaching as HYPR Corp. Files FIPS 140-2 Level 3 Validation for Its Proprietary Biometric Token 2Government Ready Biometric Security Approaching as HYPR Corp. Files FIPS 140-2 Level 3 Validation for Its Proprietary Biometric Token 3
... change is one of the major challenges facing the international ... had a significant impact on the distribution of the sea ... the Arctic. There is a close connection between the Arctic ... Denmark at present is due to the polar front extending ...
... be performed successfully in 95 percent of young children ... the February 2013 issue of OtolaryngologyHead and Neck ... procedure with varying reported success rates ranging between 35 ... success in children is often perceived as lagging behind ...
... recent article in the Chronicle of Higher ... announced it was considering anonymity in the review ... ) Ge Wang, adjunct professor of biomedical ... Forest University School of Biomedical Engineering and Sciences ...
Cached Biology News:Aarhus University builds research station in North Greenland 2Aarhus University builds research station in North Greenland 3Virginia Tech adjunct and colleagues refute a study on 'racial bias' report in NIH awards 2Virginia Tech adjunct and colleagues refute a study on 'racial bias' report in NIH awards 3
(Date:7/2/2015)... 2, 2015  Spherix Incorporated (Nasdaq: SPEX ) -- an ... monetization of intellectual property, today announced a litigation update. ... v. Verizon Services Corp. et al. , Case No. ... Eastern District of Virginia , the ... interpreting certain key claims in favor of the Defendants ...
(Date:7/1/2015)... ... July 01, 2015 , ... It is now possible ... using single photon emission computed tomography (SPECT) according to researchers from Amen ... examined over 20,000 brain scans and is believed to be the largest brain imaging ...
(Date:7/1/2015)... AURORA, Colo. and BANGALORE, India ... a global genomic profiling company that uses next generation ... appointment of Scott A. Storrer as chief ... and CEO, he will be responsible for all strategy, ... Vijay Chandru , who has served as Strand,s chairman ...
(Date:7/1/2015)... ... July 01, 2015 , ... A newly launched business plan contest ... the barriers to innovation in life sciences R&D. The Pistoia Alliance President’s Startup Challenge ... of US$15,000 and a period of expert mentorship from a senior industry figure drawn ...
Breaking Biology Technology:Spherix Issues A Litigation Update 2Spherix Issues A Litigation Update 3Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 2Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 3Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 4Strand Life Sciences Names Scott A. Storrer CEO as Company Continues Global Expansion with Focus on Precision Medicine Product 2Strand Life Sciences Names Scott A. Storrer CEO as Company Continues Global Expansion with Focus on Precision Medicine Product 3Pistoia Alliance Launches Startup Challenge 2Pistoia Alliance Launches Startup Challenge 3
... Children,s Health International Medicine Project of, Seattle (CHIMPS) Presented at Academic ... ... Los Angeles, CHELMSFORD, Mass., April 22 El Salvador, like ... issue of major public concern. This past fall, the El Salvadoran,government ...
... Groups of febit,s ... MEDFORD, Mass., and HEIDELBERG, Germany, April 22 febit,holding ... to,the U.S. market at RNAi World Congress, which will take ... main user groups of febit,s new device,will benefit from the ...
... AMSTERDAM, Netherlands and SANTA CLARA, Calif., April 22 ... rapidly evolving field of molecular,diagnostics, and Agilent Technologies, ... which they intend to collaborate to develop new ... an agreement in,which Agendia products will continue to ...
Cached Biology Technology:ESA LeadCare(R) System Used to Identify Salvadoran Children with Lead Poisoning 2ESA LeadCare(R) System Used to Identify Salvadoran Children with Lead Poisoning 3ESA LeadCare(R) System Used to Identify Salvadoran Children with Lead Poisoning 4febit to Introduce Geniom RT Analyzer(R) to U.S. Market at RNAi World Congress 2febit to Introduce Geniom RT Analyzer(R) to U.S. Market at RNAi World Congress 3Agendia and Agilent Announce Plans to Jointly Develop New Diagnostic Tests, Extend Supply Agreement 2Agendia and Agilent Announce Plans to Jointly Develop New Diagnostic Tests, Extend Supply Agreement 3
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
... antibody raised against a partial ... Immunogen: PPP4C (NP_002711, 218 ... recombinant protein with GST tag. ... NM_002720 ...
Biology Products: