Navigation Links
Concerns raised over EU ban on ditching unwanted fish
Date:5/13/2014

ifferent, the study authors found.

Dr Robin Cook, who also worked on the research, said: "Our results highlight the importance of considering the broader ecosystem consequences of fishery management. Policy changes to reduce discards affect the food web and, without careful consideration, may dissipate or negate intended benefits.

"Inflating landing quotas to accommodate the entire catch is an inadequate solution with few conservation benefits. On the other hand, the effective reductions in harvest rates resulting from changes in fishing practices to eliminate the capture of unwanted fish can deliver conservation benefits, especially in heavily exploited systems.

"These ecological effects need to be considered alongside the practical, societal and economic issues in developing a sustainable policy."

Discarding of undersize and low-value fish by commercial fisheries is not a new problem. UK Parliamentary debates in the 1890s condemned the quantities of plaice thrown away by fishing fleets in the North Sea because they were too small to be sold.

Today, the waste of living resources due to discarding is considered unacceptable. For this reason, the EU has reformed the Common Fisheries Policy in an effort to eradicate the practice by obliging fishing vessels to land all of their catch.

The key issue for the policy is the extent to which the landing obligation is compensated by an increase in quotas. The Strathclyde research shows that full compensation, in which quotas are raised by an amount equivalent to the quantity of fish currently discarded, negates any conservation benefits. On the other hand, forcing improvements in the selectivity of fisheries by offering no compensation has dramatic conservation benefits; hence there is a trade-off between practicality and ecological benefit.


'/>"/>

Contact: Lachlan Mackinnon
corporatecomms@strath.ac.uk
44-014-154-84373
University of Strathclyde
Source:Eurekalert

Page: 1 2

Related biology news :

1. Health concerns swirl around electronic cigarettes
2. UNL research raises concerns about global crop projections
3. Rising concerns over tree pests and diseases
4. Stanford researchers say peak oil concerns should ease
5. Odor and environmental concerns of communities living near waste disposal facilities
6. Ultrafine particles raise concerns about improved cookstoves
7. Global surveys show environmental concerns rank low among public concerns
8. Chemistry resolves toxic concerns about carbon nanotubes
9. Environmental concerns increasing infectious disease in amphibians, other animals
10. Eating disorder behaviors and weight concerns are common in women over 50
11. EUCelLEX Project: Assessment of the social issues raised by the use of regenerative medicine in Euro
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/16/2014)... CRG researchers shed ... Journal of Cell Biology describes how Topo 2 disentangles ... At this very moment thousands of our body,s cells are ... body repairs damaged tissues and regenerates others like skin and ... during which the cell duplicates its genetic material and separates ...
(Date:9/16/2014)... , Sept. 16, 2014  Valencell, Inc., a leader ... as one of 18 "Showcase Companies" representing ... the annual CED Tech Venture Conference on September 16-17 ... Convention Center in Raleigh, North Carolina ... lead a discussion during the "Digital Health Spotlight Sector" ...
(Date:9/15/2014)... and gut microbes influence processes from digestion to disease ... most biodiverse terrestrial ecosystems on the planet, more is ... the tropics. Smithsonian scientists and colleagues working on Panama,s ... a single tree were home to more than 400 ... tree species contained more than 7,000 different kinds. , ...
Breaking Biology News(10 mins):Unraveling cell division 2Unraveling cell division 3Valencell, Inc. Selected as 'Showcase Company' at CED Tech Venture Conference 2014 2Smithsonian scientists discover tropical tree microbiome in Panama 2
... reefs build their structures by both producing and accumulating ... and continued vertical growth capacity of reefs. An international ... carbonate being added by Caribbean coral reefs is now ... in some habitats is as much as 70% lower. ...
... the climate began warming at the end of the last ... to a warmer climate. But how will forests adapt to ... Foundation has awarded a $1.5 million grant to Drs. Stephen ... from the University of Maryland Center for Environmental Science,s Appalachian ...
... technique have determined the precise configuration of humulones, substances ... That might not sound like a big deal ... reported in scientific literature in the last 40 years ... some types of cancer and other maladies. "Now ...
Cached Biology News:New evidence highlights threat to Caribbean coral reef growth 2New evidence highlights threat to Caribbean coral reef growth 3New study will predict how trees will adapt to rapid climate change 2Beer's bitter compounds could help brew new medicines 2
(Date:9/16/2014)... -- BCC Research reveals in its new ... the global market for stem cells is expected to ... five-year compound annual growth rate (CAGR) of 13.6%. The ... growth projections of $2.2 billion in 2014 to $3.9 ... Unlike other potential applications of bioscience, stem ...
(Date:9/15/2014)... drives classical phase transitionsthink solid, liquid, and ... the temperature drops. If phase transitions occur ... mechanics reigns, subtle fluctuations can dramatically transform ... U.S. Department of Energy,s Brookhaven National Laboratory ... frigid landscape of absolute zero to isolate ...
(Date:9/15/2014)... , Sept. 15, 2014 ... on revolutionizing the treatment of cancer through the ... cells, announced that, together with the Asbestos Disease ... Cancer Institute New South Wales (NSW) Premier,s Award ... four recipients are the hospitals that will be ...
(Date:9/15/2014)... a patient has sepsis, a life-threatening condition in which ... often too fast for antibiotics to help. A new ... a team at Harvard,s Wyss Institute for Biologically Inspired ... , "Even with the best current treatments, sepsis ... 30 percent of the time," said Mike Super, Ph.D., ...
Breaking Biology Technology:Global Market for Stem Cells to Reach $10.6 Billion in 2018; The Americas Growing at 13.9% CAGR 2Global Market for Stem Cells to Reach $10.6 Billion in 2018; The Americas Growing at 13.9% CAGR 3Elusive quantum transformations found near absolute zero 2Elusive quantum transformations found near absolute zero 3EnGeneIC Named a Recipient of the Cancer Institute NSW Premier's Award for Excellence in Translational Cancer Research 2EnGeneIC Named a Recipient of the Cancer Institute NSW Premier's Award for Excellence in Translational Cancer Research 3Blood-cleansing biospleen device developed for sepsis therapy 2Blood-cleansing biospleen device developed for sepsis therapy 3Blood-cleansing biospleen device developed for sepsis therapy 4
... ... , ... Ind. (Vocus) June 17, 2009 –- Pioneer Hi-Bred , a DuPont business, ... to bring additional corn and soybean products to growers in the marketplace. Under these ...
... 17 Campbell Alliance, the leading management consulting firm ... that it has appointed industry veterans Jon W. McGarity ... gentlemen will work directly with John Campbell, CEO of ... advise the firm,s emerging and midsize client companies. ...
... QC, June 17 /PRNewswire-FirstCall/ - BioSyntech, Inc. (TSX: ... regenerative medicine, today announced statistically significant results from ... month follow-up in the BST-CarGel(R) randomized clinical trial. ... quality due to BST-CarGel treatment was found during ...
Cached Biology Technology:Pioneer Hi-Bred and Beck's Hybrids Enter into Research and Distribution Agreements 2Pioneer Hi-Bred and Beck's Hybrids Enter into Research and Distribution Agreements 3Campbell Alliance Adds Industry Veterans Jon W. McGarity and David Lilley as Executive Vice Presidents 2Campbell Alliance Adds Industry Veterans Jon W. McGarity and David Lilley as Executive Vice Presidents 3Campbell Alliance Adds Industry Veterans Jon W. McGarity and David Lilley as Executive Vice Presidents 4BioSyntech Reports Positive Results from Pivotal Trial for BST-CarGel(R) Cartilage Repair Device 2BioSyntech Reports Positive Results from Pivotal Trial for BST-CarGel(R) Cartilage Repair Device 3BioSyntech Reports Positive Results from Pivotal Trial for BST-CarGel(R) Cartilage Repair Device 4BioSyntech Reports Positive Results from Pivotal Trial for BST-CarGel(R) Cartilage Repair Device 5
... Knockout System provides optimized reagents and protocols ... bacterial genes by insertion of group II ... of group II introns and utilizes a ... group II intron for specific insertion into ...
... monoclonal antibody raised against a partial recombinant MAK. ... a.a. ~ 457 a.a) partial recombinant protein with ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Biology Products: