Navigation Links
Columbia engineers map energy use in NYC buildings

New York, NY -- Cities across the globe are trying to develop plans to cut down their energy consumption and lower their carbon footprint by reducing the associated greenhouse gas emissions. While initial efforts have focused on individual buildings by incorporating more energy efficient lighting, windows, and building systems, deeper reductions will call for changes beyond individual buildings, requiring a rethinking of how future infrastructure and energy policies should evolve.

A new study by Columbia Engineering School will help urban planners, policy makers, and engineers understand the local dynamics of building energy use in New York Citywhere over two-thirds of the energy consumption is from buildingsand help jumpstart the exchange of ideas.

"The lack of information about building energy use is staggering," said the study's lead author Bianca Howard, a Ph.D. student in mechanical engineering at Columbia Engineering. "We want to start the conversation for the average New Yorker about energy efficiency and conservation by placing their energy consumption in the context of other New Yorkers. Just knowing about your own consumption can change your entire perspective."

The study, which Howard conducted with Mechanical Engineering Professor Vijay Modi, was published in the November 7, 2011, online edition of Energy and Buildings and is featured in the February 2012 print edition. The research team included collaborators from Columbia's School of International and Public Affairs, the Earth Institute at Columbia University, and the Mayor's Office of Long-Term Planning and Sustainability.

"This is a critical issue," said Modi. "While discussions frequently focus on electricity use, homes in New York City, whether a townhouse or a large apartment building, use far more energy in form of heat rather than electricity. Nearly all of this heat is obtained from heating oil or natural gas. In addition, current electricity d

Contact: Holly Evarts
Columbia University

Page: 1 2 3

Related biology news :

1. New Columbia engineering technique diagnoses non-periodic arrhythmias in a single heartbeat
2. Columbia River salmon are adapting to climate change
3. Columbia engineering innovative hand-held lab-on-a-chip could streamline blood testing worldwide
4. Columbia Engineering team makes major step in improving forecasts of weather extremes
5. Columbia engineers develop new method to diagnose heart arrhythmias
6. Columbia researchers find green roof is a cost-effective way to keep water out of sewers
7. Columbia engineers patch a heart
8. Columbia professor to discuss good, bad aspects of choice at NJIT March 23 talk
9. Columbia engineer observes surprising behavior of cells during blood-vessel formation
10. Columbia University uses technological innovation to study bone structure
11. Columbia University Medical Center announces 2010 Katz Prizes in cardiovascular research
Post Your Comments:
(Date:9/23/2014)... the development of animals and plants. The central problem ... translated in a reliable manner to give specific spatial ... of stripe formation is a classic paradigm in developmental ... the French flag, is caused by a gradient of ... low concentrations of the morphogen a "blue", "white" or ...
(Date:9/23/2014)... SPRINGS, Florida , September 23, 2014 ... for innovative companies in tech sector position for significant investor ... products & services.  Companies in focus today are: NXT-ID, Inc. ... BABA ), Mobileye N.V. (NYSE: MBLY ... Robotics Ltd. (NASDAQ: RWLK) NXT-ID, Inc. (NASDAQ: ...
(Date:9/22/2014)... Many native species have vanished from tropical islands ... scientists have discovered how fossils can be used ... lies in organic materials found in fossil bones, ... according to a new study available online and ... of Herpetology . Pre-human island ecosystems provide vital ...
Breaking Biology News(10 mins):Recreating the stripe patterns found in animals by engineering synthetic gene networks 2Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 2Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 3Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 4Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 5Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 6Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 7Answer to restoring lost island biodiversity found in fossils 2
... , HERNDON, Va., Dec. 15 The PTR ... announced that it has agreed to sponsor three high school teams ... ). , The PTR Group will provide funding ... teams from Atholton HS in Columbia, MD, Rockwall HS in Rockwall, ...
... often promoted as a clean-burning, renewable fuel that could help ... caused by ozone, compared with gasoline, especially in winter, according ... Ozone production from both gasoline and E85, a blend of ... in warm sunny weather than during the cold weather and ...
... 10, 2009If you are spending the holidays with big Uncle ... be better off with another family, spare a thought for ... McMaster University and the University of New South Wales has ... members make strategic decisions about their living situation. ...
Cached Biology News:The PTR Group Announces Financial and Technical Support to US FIRST Robotics Competition Teams 2Ethanol-powered vehicles generate more ozone than gas-powered ones 2Ethanol-powered vehicles generate more ozone than gas-powered ones 3
(Date:9/23/2014)... September 23, 2014 This is ... Global and China Isopropanol (IPA) industry. The report ... definitions, applications and industry chain structure. Global market ... with a focus on history, developments, trends and ... the international and Chinese situation is also offered. ...
(Date:9/23/2014)... York , September 23, 2014 ... leading provider of  Closed System Transfer     Devices ... exclusive partnership with Taiwanese distributor MedFront Medical Technology Corporation.  Equashield,s ... in Taiwan , ... as the company continues to expand globally, and ...
(Date:9/23/2014)... (PRWEB) September 23, 2014 Dr. Williams ... third book on healthcare offers a three phase process ... century healthcare delivery system that would go far beyond ... responsibility regarding the delivery of healthcare.” , “Every effort ... has failed to provide discernable progress throughout that system ...
(Date:9/23/2014)... 2014 New spin-out from ... Cambridge Innovation Capital and Johnson & Johnson Development ... company focused on harnessing the potential of circulating ... and treatment, today announced it has raised £4m ... and including Cambridge Innovation Capital and Johnson & ...
Breaking Biology Technology:(IPA) Isopropanol Industry International & China Development Trend Analysis Now Available at 2(IPA) Isopropanol Industry International & China Development Trend Analysis Now Available at 3Equashield Enters Taiwan Following Expansion to Australia, Japan, China 2Dr. Ira Williams Offers the Healthcare Solution Necessary for Patient Safety Improvement 2Inivata Raises £4m to Realise the Potential of ctDNA Analysis to Improve Cancer Treatment Through Simple Blood Tests 2Inivata Raises £4m to Realise the Potential of ctDNA Analysis to Improve Cancer Treatment Through Simple Blood Tests 3Inivata Raises £4m to Realise the Potential of ctDNA Analysis to Improve Cancer Treatment Through Simple Blood Tests 4
... (NASDAQ: NEOG ) announces the following Webcast:What: ... 26, 2011 @ 11:00 ETWhere: , How: ... on to the web at the address above.  Contact: ... are unable to participate during the live webcast, the ...
... ,   Elsevier, a ... services, today announced the,highlights of its journal Impact Factor ... ® ,published by Thomson Reuters, Elsevier saw over 55% ... while slightly over 49%,of non-Elsevier journals showed an increased ...
... ,   Executives from O2h ... agreement to substantially,increase the number of FTE chemists provided by ... Congreve, Head of Chemistry at Heptares said, "O2h has,been a ... our synthetic chemistry team to include a full lab unit ...
Cached Biology Technology:Elsevier Announces 2010 Journal Impact Factor Highlights 2Elsevier Announces 2010 Journal Impact Factor Highlights 3Oxygen Healthcare (O2h) Announces Expanded Chemistry Collaboration With Heptares Therapeutics 2
Mouse monoclonal antibody raised against a partial recombinant DENR. NCBI Entrez Gene ID = DENR...
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Biology Products: