Navigation Links
Coastal management cooperation, enforcement key to avoid pending crisis for millions: U.N. experts
Date:6/4/2008

Current coastal management practices are ineffective and their continuation endangers ecosystems that support the economies on which over half the worlds population depend, United Nations University experts warn in a new report offering a major prescription for sweeping change.

In a blunt assessment, to be presented Weds. June 4 at UN Headquarters, New York, UNUs Canadian-based International Network on Water, Environment and Health warns of a looming, potentially terminal disaster in several coastal areas unless we introduce much more effective management immediately.

Coastal marine ecosystems have declined progressively in recent decades due to the growth of human populations and their demands on the marine environment and resources, according to the report.

Bays and estuaries, sea grasses, and mangroves and wetlands have suffered dramatically in the past 50 years. Shorelines have hardened, channels and harbors have been dredged, soil dumped, submerged and emergent land moved, and patterns of water flow modified. And today climate change is starting to add further stress, leading some scientists to predict the total disappearance of coral reefs in some parts of the world.

It is a recipe for disaster for the 40% of all people today who live within 50 km of fast-growing coastal areas, according to the report, co-authored by UNU-INWEHs Assistant Director Peter Sale and Programme Officer Hanneke Van Lavieren; Mark J. Butler IV, Old Dominion University, Virginia; Anthony J. Hooten, AJH, Environmental Services, Bethesda, MD; Jacob P. Kritzer, Senior Scientist, Environmental Defense Fund, Boston, MA; Ken Lindeman, Florida Institute of Technology, Melbourne FL; Prof. Yvonne Sadovy de Mitcheson, University of Hong Kong; and Prof. Bob Steneck, University of Maine.

It is past time to implement truly integrated coastal zone management around the world, says UNU-INWEH Director Zafar Adeel. Management must be scaled a
'/>"/>

Contact: Terry Collins
terrycollins@rogers.com
416-538-8712
United Nations University
Source:Eurekalert

Page: 1 2 3 4 5 6

Related biology news :

1. NOAA reports coastal waters show decline in contaminants
2. Small streams mitigate human influence on coastal ecosystems
3. Scientists show that streams are critical to preservation of oceanic coastal zones
4. River plants may play major role in health of ocean coastal waters
5. Bad news for coastal ocean: less fish out, means more nitrogen in
6. Generalist bacteria discovered in coastal waters may be more flexible than known before
7. Resilience concepts poised to aid management of coastal marine ecosystems
8. Abel to receive posthumous Ocean and Coastal Leadership award
9. Springer will publish Journal of Coastal Conservation
10. Acid rain has a disproportionate impact on coastal waters
11. Low oxygen in coastal waters impairs fish reproduction
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/24/2015)... 2015 Biometry authentication provider KeyLemon today ... solution one face in. Logo ... face in, entering the expanding biometric authentication market ... biometric answer to the password problem. With advanced ... with KeyLemon, one face in allows users to ...
(Date:6/23/2015)... GARDENS, Fla. , June 23, 2015 ... identity management and authentication solutions, today announced enhanced ... strong, multi-factor authentication solution.  The enhancements build ... use of the DigitalPersona Altus platform and ... reader compatibility. In today,s environment ...
(Date:6/17/2015)... , and HILDEN, Germany , June ... QGEN ; Frankfurt Prime Standard: QIA) today launched new Investigator ... in forensic laboratories in the United States ... to simultaneously analyze multiple key genomic markers (short tandem repeats ... Quality Sensor to evaluate the quality of DNA in ...
Breaking Biology News(10 mins):KeyLemon Announces Partnership With Biometric Password Solution onefacein 2Crossmatch Releases Enhanced DigitalPersona Altus Advanced Authentication Functionality 2QIAGEN Launches New Genetic Fingerprinting Kits for U.S. Forensic Labs 2QIAGEN Launches New Genetic Fingerprinting Kits for U.S. Forensic Labs 3QIAGEN Launches New Genetic Fingerprinting Kits for U.S. Forensic Labs 4QIAGEN Launches New Genetic Fingerprinting Kits for U.S. Forensic Labs 5
... fewer television advertisements for certain foods, including those for ... to a report posted online today that will appear ... Pediatrics & Adolescent Medicine , one of the JAMA/Archives ... racial gaps in exposure to all food advertising have ...
... Saber-toothed cats may be best known for their supersized canines, ... before delivering the fatal bite, says a new study in ... "saber-toothed tiger," the extinct cat Smilodon fatalis roamed ... large mammals such as bison, camels, mastodons and mammoths. Telltale ...
... worry about the effects of air pollution on their health ... and fine particles in the air during pregnancy does not ... -- a serious condition that arises only during pregnancy -- ... at Buffalo epidemiologist. , The research was conducted in ...
Cached Biology News:Kids now see fewer television ads for sweets and beverages, but more for fast food 2Why you should never arm wrestle a saber-toothed tiger 2Air pollution doesn't increase risk of preeclampsia, early delivery, study finds 2
(Date:6/30/2015)... SAN DIEGO , June 30, 2015 /PRNewswire/ ... Continuing Education in Biosciences (CCE/Bio) and UC San ... microbial fermentation, to be held Aug.  12 – ... agenda ).  This three-day workshop provides an intense ... in industrial biotechnology, and is well-suited to biologists, ...
(Date:6/30/2015)... VANCOUVER , June 30, 2015 /PRNewswire/ - ... a clinical stage regenerative medicine company focused on ... the first participant in its Phase 1/2 clinical ... of chronic unilateral Achilles tendinosis, has been enrolled ... to intra-tendon ultrasound-guided injections. RCT-01 is comprised of ...
(Date:6/30/2015)... ... June 30, 2015 , ... ... has accepted the position of vice president of instruction at Chippewa Valley Technical ... “I greatly appreciated the opportunity to lead SIUE during the past three years,” ...
(Date:6/30/2015)... ... June 30, 2015 , ... ... launched “Cannavoices,” an unprecedented digital video and broadcast initiative. Produced by filmmakers, the ... dynamic collection of legal medical cannabis stories ever assembled. , Cannavoices profiles ...
Breaking Biology Technology:UC San Diego Extension to Offer Third Annual Microbial Fermentation Workshop 2RepliCel Life Sciences Enrolls First Participant in Phase 1/2 Clinical Trial of RCT-01 for Chronic Achilles Tendinosis 2RepliCel Life Sciences Enrolls First Participant in Phase 1/2 Clinical Trial of RCT-01 for Chronic Achilles Tendinosis 3RepliCel Life Sciences Enrolls First Participant in Phase 1/2 Clinical Trial of RCT-01 for Chronic Achilles Tendinosis 4SIUE’s Furst-Bowe Accepts VP of Instruction at CVTC 2SIUE’s Furst-Bowe Accepts VP of Instruction at CVTC 3Cannavoices Launches a Legal Medical Cannabis Documentary Initiative 2Cannavoices Launches a Legal Medical Cannabis Documentary Initiative 3
... Senior Management Form Company ... and Podiatry Markets, FAIRFIELD, N.J., May 13 ... newly-formed,Company, led by the founder and the key Senior ... ), will develop, license and,commercialize innovative prescription products for ...
... with CelVida Yields First Milestone, NEW YORK, May ... pioneering the pre-disease collection, processing and long-term,storage of adult ... a,site has been secured for a new stem cell ... Robin Smith, MD MBA, NeoStem,s Chairman and Chief ...
... Pte Ltd today announced that,the U.S. Food and ... SB1518, its potent and orally-active JAK2 inhibitor for ... S*BIO,s,application upon review of preclinical data which demonstrated ... of the JAK2 inhibitor., "We are pleased ...
Cached Biology Technology:Medimetriks Pharmaceuticals, Inc. Begins Operations 2NeoStem to Expand Stem Cell Collection Center Network to Florida 2NeoStem to Expand Stem Cell Collection Center Network to Florida 3S*BIO Receives Orphan Drug Designation for JAK2 Inhibitor SB1518 for the Treatment of Myeloproliferative Disorders 2
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
... antibody raised against a partial ... Immunogen: PPP4C (NP_002711, 218 ... recombinant protein with GST tag. ... NM_002720 ...
Biology Products: