Navigation Links
Chip Supply Hosts Visit by U.S. Senator George LeMieux
Date:8/13/2010

ORLANDO, Fla., Aug. 11 /PRNewswire/ -- Chip Supply, Inc., a global provider of semiconductor die and specialized packaging solutions, was pleased to host a visit yesterday by U.S. Senator George LeMieux (R-FL) to its corporate headquarters. The Senator, who is a co-sponsor of the Export Promotion Act (bipartisan legislation aimed at increasing export trade in the small business sector), met with Chip Supply to review, firsthand, how federal export promotion could expand sales opportunities for small businesses in Florida and increase job creation within the state.

Chip Supply President and CEO, Edward Perrott, who welcomed Senator LeMieux to the company and took him on a tour of the campus and facilities, provided an overview of the company's products and services, the current markets served, both domestically and globally, and the growth opportunities within each. "It was both a pleasure and an honor to have Senator LeMieux visit our facility today, and we greatly appreciate the interest he took in our business, as well as his obvious commitment to help businesses, like ours, compete successfully in the global economy," said Perrott.

While at Chip Supply, the Senator hosted a short news conference to emphasize the importance of the passage of the Export Promotion Act both to small businesses and Florida's overall economic growth.

About Senator LeMieux

George LeMieux is a native Floridian, who grew up in Broward County, Florida. On September 10, 2009, LeMieux was sworn into the U.S. Senate to fulfill the remainder of Senator Mel Martinez's unexpired term. Senator LeMieux currently serves on the Armed Services Committee, the Commerce, Science & Transportation Committee, the Special Committee on Aging, and the China Commission. Senator LeMieux, along with Senator Mary Landrieu (D-LA), recently introduced the Export Promotion Act as part of their bipartisan amendment to the Small Business Lending Bill to increase the Department
'/>"/>

SOURCE Chip Supply, Inc.
Copyright©2010 PR Newswire.
All rights reserved

Page: 1 2

Related biology news :

1. Eurofins MWG Operon signs contract to supply oligonucleotides to Research Councils
2. Supply and demand
3. Some trees farm bacteria to help supply nutrients
4. Does the existing standard of care supply energy sources to brain tumor cells?
5. Chip Supply Welcomes Lupton Associates to Sales Team
6. Multicard to Supply Secure IT Kits Under German Federal Governments Electronic ID Program
7. SCM Microsystems to Supply Readers for German Electronic ID Program
8. Experts identify biological control to contain fungus killer in Kenyas maize supply
9. Contaminants in groundwater used for public supply
10. Peak P? Phosphorus, food supply spurs Southwest initiative
11. Obesity and passive smoking reduce oxygen supply to unborn baby
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:4/17/2014)... a novel method to help kidney stone sufferers ... treatment possible., Kidney stones represent a major medical ... left untreated, apart from being particularly painful, they ... In many patients treated successfully, stone recurrence is ... approach to diagnosis and treatment needs to be ...
(Date:4/17/2014)... whereby the genetic information of DNA is used ... have numerous different functions in living organisms. Messenger ... gene expression, by relating the genetic information of ... proteins. , By examining the different types ... organism at a given time, researchers can determine ...
(Date:4/17/2014)... View of Domestication," a special feature of The ... ( PNAS ) published April 29, raises a ... deep history that most of us take for granted. ... in many spots around the globe shifted from hunting ... and plants. , It seems so straightforward and yet ...
Breaking Biology News(10 mins):Rapid and accurate mRNA detection in plant tissues 2Genetic study tackles mystery of slow plant domestications 2Genetic study tackles mystery of slow plant domestications 3Genetic study tackles mystery of slow plant domestications 4
... NYJuly 28, 2011A new study co-authored by Columbia Engineering ... Environmental Science & Technology , shows that reducing ... with "sizable" economic benefits, as well as the expected ... five scientists from around the U.S. who worked on ...
... -- (July 28, 2011) -- The DNA evidence is in, ... more than 1,000 Chinese tallow trees from the United States ... the tallow trees that are overrunning thousands of acres of ... widely known that Franklin introduced tallow trees to the U.S. ...
... the Food and Drug Administration approved a drug called ... African-American patients, claiming in a press release that this ... Invention: How Science, Politics and Big Business Re-create Race ... Roberts, the Kirkland & Ellis Professor at Northwestern University ...
Cached Biology News:New study outlines economic and environmental benefits to reducing nitrogen pollution 2New study outlines economic and environmental benefits to reducing nitrogen pollution 3Genetic evidence clears Ben Franklin 2Genetic evidence clears Ben Franklin 3Divided by race 2
(Date:1/15/2014)... 15, 2014 TaiGen Biotechnology Company, Limited ("TaiGen") today ... R-Pharm, a leading Russian pharmaceutical company, to develop and ... Russian Federation , Turkey ... is a novel antibiotic for the treatment of bacterial ...
(Date:1/14/2014)... Carahsoft and CDS Federal Services have scheduled a ... EST (11am PST), “Natural Language Processing: Converting Raw Data ... can turn raw, heterogeneous data into actionable knowledge to ... webinar will last approximately one hour. , Synopsis: Big ...
(Date:1/14/2014)... , Jan. 14, 2014  3D Communications, a leading provider of strategic ... business, and media events in the United States ... associate Virginia Cox , JD, is returning to the firm,s ... Cox re-joins 3D after more than two years of service ...
(Date:1/14/2014)... 2014 EquitiesIQ, a leading informational research ... Alliqua is an emerging biomedical company acquiring, developing, manufacturing, ... market. , Free report download: http://equitiesiq.com/reports/alliqua/ , ... management team and Board, which launched the company’s new ...
Breaking Biology Technology:TaiGen Biotechnology Signed Exclusive License Agreement with R-Pharm for Nemonoxacin (Taigexyn(R)) 2TaiGen Biotechnology Signed Exclusive License Agreement with R-Pharm for Nemonoxacin (Taigexyn(R)) 3TaiGen Biotechnology Signed Exclusive License Agreement with R-Pharm for Nemonoxacin (Taigexyn(R)) 4Webcast - Natural Language Processing: Converting Raw Data into Actionable Knowledge – Hosted by Carahsoft and CDS Federal Services 2Former FDA Associate Commissioner Returns To 3D Communications 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 3
... ... , ... Waterville, ME (Vocus) April 15, 2010 -- Cerealus Holdings, in collaboration with the ... Next Generation Strength + Retention System.” Originally patented by DuPont and later developed ...
... ... attendance at the Partec/Powtech/WCPT6 on April 26-29 in Nuremberg, Germany. Visit ... range including FBRM® C35, PVM® V819, and S400 laboratory probes. In ... three posters and one paper. FBRM® and PVM® technology will also ...
... ... reporting and ad hoc analysis , ... (PRWEB) April 13, 2010 -- Like many customer-oriented organizations, Maine Medical ... its data. The program manages behavioral healthcare for 69,000 recipients in Maine, New ...
Cached Biology Technology:Cerealus Announces Licensing Agreement for Bio-Based Ceregel™, A Next Generation Strength and Retention System 2Track Particle Distribution in Real Time 2Track Particle Distribution in Real Time 3Maine Medical Center Chooses Business Intelligence Solution from Rapid Insight Inc. 2
Mouse monoclonal antibody raised against a full length recombinant CSNK2A2. NCBI Entrez Gene ID = CSNK2A2...
... DNA Visualizer Extraction Kit is manufactured ... causing DNA damage byexposure to UV light. ... gel is often used for DNA-cloning work. ... ethidium bromide and exposure of UV light ...
... Mouse monoclonal antibody raised against a partial ... (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant ... Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: ... AAH39825 OMIM: 154235, ...
Mouse monoclonal antibody raised against a partial recombinant L3MBTL2. NCBI Entrez Gene ID = L3MBTL2...
Biology Products: