Navigation Links
Case study analyzes why, where and when of leading shark attack site
Date:5/26/2010

GAINESVILLE, Fla. Shark attacks are most likely to occur on Sunday, in less than 6 feet of water, during a new moon and involve surfers wearing black and white bathing suits, a first of its kind study from the University of Florida suggests.

Researchers analyzed statistics from shark attacks that occurred in Florida's Volusia County, dubbed the "Shark Attack Capital of the World," between 1956 and 2008. They also spent a year observing people between Daytona Beach and New Smyrna Beach, said George Burgess, director of the International Shark Attack File at UF.

"It's basically an analysis of why, where and when in an area that traditionally has had more shark-human interactions than any other stretch of coastline in the world," he said. "One of our students, Brittany Garner, essentially camped out there, counted the number of heads on the beach and took photographs."

While this 47-mile-long section of Central Florida's Atlantic coast leads in human-shark skirmishes, making up 21 percent of all global attacks between 1999 and 2008, most are "hit and run" incidents that seldom cause serious injury and no fatalities occurred, he said.

"Calling them attacks is probably a misnomer because the consequences are usually no more severe than a dog bite," he said. "They're not the same kind of bites made by 10- to 20-foot-long white sharks that you have off the coast of California. Here we see a different style of attack, primarily perpetrated by smaller fish-eating sharks such as spinners and blacktips that are less than 6 to 7 feet long, which because of their size normally seek smaller prey."

There have been 231 shark attacks between the first one reported in 1956 in Volusia County and 2008, said Burgess, who works at UF's Florida Museum of Natural History. The study, part of which was published recently in the edited volume "Sharks and Their Relatives II," uses statistics from 220 of those cases for which detailed informat
'/>"/>

Contact: George Burgess
gburgess@flmnh.ufl.edu
352-392-2360
University of Florida
Source:Eurekalert

Page: 1 2 3

Related biology news :

1. Study pinpoints new role of molecule in the health of bodys back-up blood circulation
2. Study finds high level of bacteria in bottled water in Canada
3. Study sheds light on how marine animals survive stress
4. Stem-cell disruption induces skull deformity, UR study shows
5. New study first to directly measure body temperatures of extinct species
6. Scientists to study impact of gulf oil spill on marine food webs
7. Obesity remains an economic issue, Seattle obesity study finds
8. NIH funds multicenter glue grant to study enzyme function
9. TEEB study leader emphasizes urgent need for action on biodiversity loss
10. Study uncovers optimal ecology of bioinsecticide
11. New lab manual for studying the biology of the nervous system in Drosophila is released
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/23/2015)... BEACH GARDENS, Fla. , June 23, ... multi-factor identity management and authentication solutions, today announced ... Altus strong, multi-factor authentication solution.  The enhancements ... of use of the DigitalPersona Altus platform ... biometric reader compatibility. In today,s ...
(Date:6/17/2015)... , and HILDEN, Germany , June ... QGEN ; Frankfurt Prime Standard: QIA) today launched new Investigator ... in forensic laboratories in the United States ... to simultaneously analyze multiple key genomic markers (short tandem repeats ... Quality Sensor to evaluate the quality of DNA in ...
(Date:6/16/2015)... NEW YORK , June 16, 2015  With ... the world, security remains a top concern. The recent ... confirms the need for strong authentication within government ... HYPR Token, a biometric one-time password (OTP) authenticator, has ... Processing Standards (FIPS) 140-2 Level 3 validation for tamper ...
Breaking Biology News(10 mins):Crossmatch Releases Enhanced DigitalPersona Altus Advanced Authentication Functionality 2QIAGEN Launches New Genetic Fingerprinting Kits for U.S. Forensic Labs 2QIAGEN Launches New Genetic Fingerprinting Kits for U.S. Forensic Labs 3QIAGEN Launches New Genetic Fingerprinting Kits for U.S. Forensic Labs 4QIAGEN Launches New Genetic Fingerprinting Kits for U.S. Forensic Labs 5Government Ready Biometric Security Approaching as HYPR Corp. Files FIPS 140-2 Level 3 Validation for Its Proprietary Biometric Token 2Government Ready Biometric Security Approaching as HYPR Corp. Files FIPS 140-2 Level 3 Validation for Its Proprietary Biometric Token 3
... Argonne National Laboratory has signed a memorandum ... (SRNL) to collaborate on nuclear energy and environmental ... Energy Department (DOE) needs and other important national ... a leader in nuclear energy research," Argonne director ...
... Maneuvering through a room full of people. Jumping out of ... these seemingly simple actions require us to perceive and quickly ... Rensselaer Polytechnic Institute Mark Changizi argues they require something moreour ... nearly one-tenth of a second to translate the light that ...
... has detected the molecule hydroxyl on another planet for ... new tool to unlock the workings of Venuss dense ... made up of a hydrogen and oxygen atom each. ... the Venusian atmosphere, some 100 km above the surface, ...
Cached Biology News:Argonne-SRNL agreement supports critical DOE, national priorities 2Crystal (eye) ball: Study says visual system equipped with 'future seeing powers' 2Crystal (eye) ball: Study says visual system equipped with 'future seeing powers' 3Key molecule discovered in Venus's atmosphere 2
(Date:7/2/2015)... 2, 2015  Spherix Incorporated (Nasdaq: SPEX ) -- an ... monetization of intellectual property, today announced a litigation update. ... v. Verizon Services Corp. et al. , Case No. ... Eastern District of Virginia , the ... interpreting certain key claims in favor of the Defendants ...
(Date:7/1/2015)... ... July 01, 2015 , ... It is now possible ... using single photon emission computed tomography (SPECT) according to researchers from Amen ... examined over 20,000 brain scans and is believed to be the largest brain imaging ...
(Date:7/1/2015)... AURORA, Colo. and BANGALORE, India ... a global genomic profiling company that uses next generation ... appointment of Scott A. Storrer as chief ... and CEO, he will be responsible for all strategy, ... Vijay Chandru , who has served as Strand,s chairman ...
(Date:7/1/2015)... ... July 01, 2015 , ... A newly launched business plan contest ... the barriers to innovation in life sciences R&D. The Pistoia Alliance President’s Startup Challenge ... of US$15,000 and a period of expert mentorship from a senior industry figure drawn ...
Breaking Biology Technology:Spherix Issues A Litigation Update 2Spherix Issues A Litigation Update 3Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 2Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 3Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 4Strand Life Sciences Names Scott A. Storrer CEO as Company Continues Global Expansion with Focus on Precision Medicine Product 2Strand Life Sciences Names Scott A. Storrer CEO as Company Continues Global Expansion with Focus on Precision Medicine Product 3Pistoia Alliance Launches Startup Challenge 2Pistoia Alliance Launches Startup Challenge 3
... Group today announced its,plans to seek a listing of ... Europe and the Middle East. In a statement released ... Oji said that "this,was part of a comprehensive growth ... years. Chrome recently signed a Memorandum,of Understanding with Petrobras ...
... agent to move forward in Phase III ... PeriCor Therapeutics announced today,that its licensing agreement ... The agreement grants Schering-Plough exclusive,worldwide rights for ... acadesine. Financial terms of the transaction were ...
... Advanced Cell,Technology, Inc. (OTC Bulletin Board: ACTC) ... plans to privately offer up to $10,000,000,of senior ... the,closing of the offering will be subject to ... to be used to fund working capital, including,costs ...
Cached Biology Technology:Chrome Group to Seek Listing for Some of its Subsidiaries 2Chrome Group to Seek Listing for Some of its Subsidiaries 3Chrome Group to Seek Listing for Some of its Subsidiaries 4PeriCor Therapeutics Announces Closing of Licensing Agreement for Acadesine with Schering-Plough Corporation 2PeriCor Therapeutics Announces Closing of Licensing Agreement for Acadesine with Schering-Plough Corporation 3Advanced Cell Technology Announces Proposed Financing 2Advanced Cell Technology Announces Proposed Financing 3
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
... antibody raised against a partial ... Immunogen: PPP4C (NP_002711, 218 ... recombinant protein with GST tag. ... NM_002720 ...
Biology Products: