Navigation Links
Caltech scientists get detailed glimpse of chemoreceptor architecture in bacterial cells
Date:9/24/2009

a search for better conditions."

"One of the remarkable things about this system," says Jensen, "is that the chemoreceptors are exquisitely sensitive to changes in the concentrations of positive and negative stimuli."

Scientists believe that this sensitivity is due to the way the hundreds of chemoreceptors cluster together in the bacterial cell. "It is known that if one receptor binds a stimulus molecule, it turns on other receptors around it as well to amplify the signal," Jensen explains. "The whole system also adapts to changing conditions, dynamically adjusting the range of concentrations that it responds to."

To fully understand just what is happening in these cells, Jensen says, it is thus important to figure out the ways in which these receptors interact with one another, which in turn depends on understanding precisely how they are situated in relation to one another.

In other words, scientists need to be able to "see" the internal architecture of the bacterial cell and, in particular, how its chemoreceptors are arrayed.

Jensen and his team were able to get just such a glimpse at the chemoreceptor architecture at the macromolecular level, thanks to a state-of-the-art electron cryomicroscope that was purchased with a gift from the Gordon and Betty Moore Foundation.

"The electron cryomicroscope allows us to see the arrangement of individual proteins inside cells in a lifelike state," says Jensen. "To do this, living cells are quickly frozen so that all the proteins are frozen in placein the same places they were in the living state."

The high-tech microscope allowed the researchers to take 3-D images of intact cells through a technique called electron cryotomography. The researchers looked at some 700 tomographic imagesor tomogramsof bacterial cells, says Caltech postdoctoral scholar Ariane Briegel, the first author on the PNAS paper, and an HHMI associate. "This is the first time such
'/>"/>

Contact: Lori Oliwenstein
lorio@caltech.edu
626-395-3631
California Institute of Technology
Source:Eurekalert  

Page: 1 2 3 4

Related biology news :

1. Caltech neuroscientists find brain region responsible for our sense of personal space
2. Caltech researchers explore how cells reconcile mixed messages in decisions about growth
3. Caltech scientists reveal how neuronal activity is timed in brains memory-making circuits
4. Caltech scientists show why anti-HIV antibodies are ineffective at blocking infection
5. Caltech scientists control complex nucleation processes using DNA origami seeds
6. Caltech researchers train computers to analyze fruit-fly behavior
7. Caltech and UCSD researchers shed light on how proteins find their shapes
8. Caltech researchers help unlock the secrets of gene regulatory networks
9. Caltech researchers get first look at how groups of cells coordinate their movements
10. Caltech scientists show function of helical band in heart
11. Caltech scientists develop barcode chip for cheap, fast blood tests
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
Caltech scientists get detailed glimpse of chemoreceptor architecture in bacterial cells
(Date:8/20/2014)... LAKE CITY Researchers at Huntsman Cancer Institute (HCI) at ... forms of the gene that encodes BCR-ABL, the unregulated ... According to the American Cancer Society, nearly 6,000 new ... Drugs already in use, called tyrosine kinase inhibitors (TKIs), ... They do not cure CML but control it in ...
(Date:8/20/2014)... State University, the Wellcome Trust Sanger Institute and the ... Mycobacterium pinnipedii from skeletons found in Peru ... is a relative of the TB bacterium that affects ... These researchers assume that seals carried the pathogens from ... lions was unexpected" comments Sebastien Gagneux, from the Swiss ...
(Date:8/20/2014)... Bay Area Lyme Foundation, which aims to make Lyme ... new research published in an upcoming issue of the ... . The findings show that ticks that carry ... year, making the threat of Lyme disease year-round. The ... Public Health (CDPH) Vector-borne Disease Section and University of ...
Breaking Biology News(10 mins):Blueprint for next generation of chronic myeloid leukemia treatment 2Lyme disease risk is year-round in Northwest California, according to new study 2Lyme disease risk is year-round in Northwest California, according to new study 3
... Following an agreement between ESA, Krunichev Space Centre and ... and a secondary payload, the technology demonstrator Proba-2 satellite, ... new November launch date follows a rescheduling of the ... Moisture and Ocean Salinity (SMOS) satellite and the secondary ...
... heat shock protein 90 gets steroid receptors into shape ... to targeted therapies for hormone-driven cancers, such as breast ... of Georgia researchers say. "We are trying to ... conformation so they work," says Dr. Ahmed Chadli, biochemist ...
... In the fruit fly,s developing brain, stem cells called ... cell that has a different fate. But neuroblast growth can ... Researchers at Duke-NUS Graduate Medical School in Singapore ... a counterpart in mammals, that can apparently prevent brain tumors ...
Cached Biology News:SMOS and Proba-2 launch rescheduled for November 2Targeting helpers of heat shock proteins could help treat cancer, cardiovascular disease 2Tumor suppressor gene in flies may provide insights for human brain tumors 2
(Date:8/21/2014)... 21, 2014 OTC Markets Group ... a biotechnology company, on its approval to list ... on OTCQX®, the best marketplace for established U.S. ... Logo - http://photos.prnewswire.com/prnh/20110118/MM31963LOGO ... execution of its growth strategy and achievement of ...
(Date:8/21/2014)... Chester, NJ (PRWEB) August 21, 2014 ... of personal selling optimization technology and services for ... publication of “Grading Pharma’s Use of New Commercial ... of Measurement & Analytics. , The article examines ... marketing yield that are being tested in the ...
(Date:8/21/2014)... SoundConnect , a unified communication ... of the nation’s Fastest Growing Private Companies by ... consecutive year. Inc. magazine today ranked SoundConnect NO. ... exclusive ranking of the nation's fastest-growing private companies. ... the most important segment of the economy—America’s independent ...
(Date:8/20/2014)... of patented university inventions licensed to biotechnology firms ... commercialization. To open these roadblocks, the researchers suggest ... the discovery stage could lead to faster commercialization ... derived from discoveries made in university laboratories and ... during clinical trials, which have a high failure ...
Breaking Biology Technology:OTC Markets Group Congratulates Immune Pharmaceuticals on NASDAQ Listing 2Pursuit's Peter Robinson Publishes "Grading Pharma's Use of New Commercial Sales Models" 2SoundConnect Returns on Inc. 5000 List of Fastest Growing Companies 2SoundConnect Returns on Inc. 5000 List of Fastest Growing Companies 3Early bottlenecks in developing biopharmaceutical products delay commercialization 2Early bottlenecks in developing biopharmaceutical products delay commercialization 3
... Yingxia,International, Inc. (OTC Bulletin Board: CYXI) ("China Yingxia" ... and nutritional food industry,engaged in the development, manufacture ... raw cactus plants in the People,s,Republic of China ... Ren,Hu will present at the upcoming Roth China ...
... Wall St. Network,s 3-Minute,Press Show is a daily program ... with public company executives on their,company and most recent ... viewers with insight into a company,s,latest news, and its ... Shows air Monday through Friday at: http://tv.wallst.net/3-min-press/3-min-press.php ...
... device company focused on developing, and commercializing interventional ... call scheduled for Tuesday, November 4, 2008 at ... PAUL, Minn., Nov. 4 ,Replidyne, Inc. (Nasdaq: ... that they have entered into a definitive merger ...
Cached Biology Technology:China Yingxia to Present at Roth China Comes to Vegas Conference 2[video] Wall St. Network's 3-Minute Press Show Features Executive Interviews and Highlights Recent Press for the Following: GTHR, BHRT, AGO 2Replidyne and Cardiovascular Systems Sign Merger Agreement 2Replidyne and Cardiovascular Systems Sign Merger Agreement 3Replidyne and Cardiovascular Systems Sign Merger Agreement 4Replidyne and Cardiovascular Systems Sign Merger Agreement 5Replidyne and Cardiovascular Systems Sign Merger Agreement 6Replidyne and Cardiovascular Systems Sign Merger Agreement 7
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
... The BD PhosFlow Perm/Wash Buffer I can ... modified signaling proteins to permeabilize cells and ... cell wash buffer. Because saponin-mediated cell permeabilization ... to keep the cells in the presence ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Rabbit polyclonal antibody to GluR2...
Biology Products: