Navigation Links
Brown tree snake could mean Guam will lose more than its birds
Date:8/7/2008

are extinct on Guam, and the other two species have fewer than 200 individuals. Though Guam has some non-native bird populations, few other birds moved in when native species died out, and none of them live in the forest. That leaves few birds to consume tree seeds and then drop them away from the trees.

That could have two possible negative impacts on the native forests, Rogers said. First, some plant species need birds to handle their seeds to ensure effective germination. In addition, seed predators and fungi that kill seeds are often found in high density directly beneath a parent tree, so the trees rely on birds to disperse seeds beyond the range of those negative effects. If native birds performed those functions on Guam, tree populations could suffer from the loss of birds. It appears 60 percent to 70 percent of tree species in the native forests are dispersed, at least in part, by birds, she said.

To test the effects of the loss of native birds on seed distribution, Rogers devised seed traps that look a bit like satellite dish receivers, with tubing bent into a circular shape and covered with fine mesh screen-door netting. She set 119 traps beneath and near Premna obtusifolia, or false elder, trees on Guam and the nearby island of Saipan, which does not have brown tree snakes. For each tree sampled, she set two traps directly beneath the tree's canopy, two about 3 feet away, three at 16 feet, three at 33 feet and seven at 65 feet.

On Saipan, Rogers and her colleagues found seeds in nearly every trap at each distance, though more seeds were found in closer traps and fewer farther away. However, on Guam the seeds appeared only in traps directly beneath the canopy. What's more, most of the farther-dispersed seeds from traps on Saipan had the seed coats removed, a factor that could speed seedling germination and the growth of new trees and something that likely could only be accomplished in the gut of a bird. None of the seeds foun
'/>"/>

Contact: Vince Stricherz
vinces@u.washington.edu
206-543-2580
University of Washington
Source:Eurekalert  

Page: 1 2 3 4

Related biology news :

1. Brown to host conference on advances in neurotechnology
2. Brown opens institute for molecular and nanoscale innovation
3. Brown scientists say biodiversity is crucial to ecosystem productivity
4. Eliminating germline lengthens fly lifespan, Brown study shows
5. Brown hosts regional bioengineering conference
6. New study changes conditions for Spanish brown bears
7. Rare North Island brown kiwi hatches at the Smithsonians National Zoo
8. Computers explain why pears may become brown during commercial storage
9. Dont judge a brook by its color -- brown waters are more natural
10. Brown scientists take the petri dish to new dimensions
11. Good earth: Brown chemists show origin of soil-scented geosmin
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
Brown tree snake could mean Guam will lose more than its birds
(Date:9/18/2014)... and their colleagues have built the first smartphone ... performance and behavioral trends. In other words, your ... if you don,t -- and how that affects ... happiness, stress, depression and loneliness to their academic ... population for example, to monitor mental health, ...
(Date:9/18/2014)... celebrated tonight at the third annual Golden Goose Award ... premature infants and in paving the way for the ... supported by the National Science Foundation, the National Institutes ... be honored at a ceremony at the Library of ... of Congress will be on hand to help present ...
(Date:9/18/2014)... when people are too stressed they are often grouchy, ... Mind Institute (BMI) at EPFL have just highlighted a ... stress and the loss of social skills and cognitive ... synaptic regulatory molecule in the brain. This was revealed ... , Carmen Sandi,s team went to look for ...
Breaking Biology News(10 mins):New Dartmouth smartphone app reveals users' mental health, performance, behavior 2New Dartmouth smartphone app reveals users' mental health, performance, behavior 3New Dartmouth smartphone app reveals users' mental health, performance, behavior 43rd annual Golden Goose award ceremony honors 8 researchers; Unusual work had big results 2How stress tears us apart 2
... DNA is copied into ribonucleic acid (RNA) molecules, also ... making proteins, and a collection of all the transcripts ... Jaiswal, Assistant Professor of Botany and Plant Pathology at ... Jaiswal,s laboratory, and colleagues assembled transcriptomes of a noxious ...
... AMHERST, Mass. Biochemists at the University of Massachusetts ... insight into how protein synthesis and degradation help to ... they reveal how two proteins shelter each other in ... and safely. Cells must routinely dispose of leftover ...
... University of Florida paleontologists have discovered remarkably well-preserved fossils ... science during recent Panama Canal excavations that began in ... and an extinct hippo-like species inhabited Central America during ... expands the range of ancient animals in the subtropics ...
Cached Biology News:Assembling the transcriptome of a noxious weed: New resources for studying how plants invade 2New insight into double-protected dance of cell division 2UF scientists discover new crocodilian, hippo-like species from Panama 2UF scientists discover new crocodilian, hippo-like species from Panama 3
(Date:9/19/2014)... YORK, September 18, 2014 Scientists at NYU Langone ... dramatically the efficiency of the process for turning adult ... well-known compounds, including vitamin C. Using the new technique ... cells obtained from adult skin cells by more than ... technique is efficient and reliable, and thus should generally ...
(Date:9/19/2014)... Sept. 19, 2014  Nektar Therapeutics (NASDAQ: ... studies characterizing the analgesic profiles of a series ... receptor agonist molecules. The preclinical research candidates were ... platform. The analgesic properties of kappa ... literature. 1,2 Kappa opioid receptors are expressed ...
(Date:9/19/2014)... -- Dublin ... the addition of the  "Micro Market Monitor : ...      (Logo: http://photos.prnewswire.com/prnh/20130307/600769) , , ,The ... segments in the chromatography market. The market was ... to reach $2.0 billion by 2019, at a ...
(Date:9/18/2014)... -- About POCT POCT, also ... laboratory. It helps in making fast clinical decisions, ... POCT is gaining popularity due to the increasing ... diabetes, heart disease, and obesity. It is generally ... minimize errors during the diagnosis of patients. POCT ...
Breaking Biology Technology:NYU Langone scientists report reliable and highly efficient method for making stem cells 2NYU Langone scientists report reliable and highly efficient method for making stem cells 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 2Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 3Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 4Nektar Presents Positive Preclinical Data on Oral, Peripherally-Acting Kappa Agonist Molecules at 2014 American Academy of Pain Management Meeting 5Micro Market Monitor : Global Pre-packed Chromatography Columns 2POCT Market in China 2014-2018 2
... , ... computational drug discovery solutions provider, announced today they have licensed ... Drug Administration,s National Center for Toxicological Research (NCTR). , Under ... access to the complete TIP structural knowledgebase via ...
... , NEW ORLEANS, Dec. 8 HemaQuest Pharmaceuticals presented data ... of its lead drug candidate, HQK-1001, in sickle cell disease ... Society of Hematology in New Orleans. The preclinical studies ... of therapeutic agents that have been used in the past ...
... ... Extended Wear Hearing Aid. , ... Newark, CA (PRWEB) December 8, 2009 -- Whether it’s a crackling fire, jingling sleigh bells, ... miss out on the joyous sounds of the holidays. Lyric, the first 100% invisible ...
Cached Biology Technology:Eidogen-Sertanty Licenses TIP to the FDA 2HemaQuest Pharmaceuticals Presents Promising Results in Sickle Cell Disease and Beta Thalassemia 2HemaQuest Pharmaceuticals Presents Promising Results in Sickle Cell Disease and Beta Thalassemia 3Lyric Presents the Sounds of the Season 2
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
...
... polyclonal antibody raised against a partial recombinant ... (AAH35357, 120 a.a. ~ 250 a.a) partial ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: