Navigation Links
Black rat does not bother Mediterranean seabirds
Date:10/2/2009

Human activities have meant invasive species have been able to populate parts of the world to which they are not native and alter biodiversity there over thousands of years. Now, an international team of scientists has studied the impact of the black rat on bird populations on Mediterranean islands. Despite the rat's environmental impact, only the tiny European storm petrel has been affected over time by its enforced cohabitation with the rat.

A European team has studied around 300 islands in the western Mediterranean, and has confirmed that the presence of the black rat (Rattus rattus) has an effect on the number of marine birds there. Mass colonisation by rats is damaging to the native biota of islands, leading to a 68% risk of extinction for procellariiforme seabirds (tube-nosed birds with webbed feet of three to four toes).

Although rats have been introduced into the islands of the Mediterranean over the past 2,000 years, "there has not been any recorded extinction of any seabird species since they first arrived on the islands in this basin", Lise Ruffino, lead author of the study and a researcher at the Mediterranean Institute of Ecology and Paleoecology (IMEP) at the Paul Czanne University in France, tells SINC.

The study, which has been published recently in Biological Invasions, has evaluated more than 50% of the islands in the western Mediterranean. The scientists found that only 31% of the small Mediterranean islands or islets (of less than five hectares) were rat-free. In fact, 99% of islands measuring more than 30 hectares have been invaded by black rats, and living alongside them has had a serious impact on the survival of four procellariiforme species.

Of the four species studied, Cory's shearwater (Calonectris diomedea diomedea), the Mediterranean shearwater (Puffinus yelkouan), the Balearic shearwater (Puffinus mauretanicus), and the European storm petrel (Hydrobates pelagicus melitensis). "The only
'/>"/>

Contact: SINC
info@plataformasinc.es
34-914-251-820
FECYT - Spanish Foundation for Science and Technology
Source:Eurekalert  

Page: 1 2

Related biology news :

1. Risk of common vaginal infection linked to preterm birth appears higher for blacks
2. Coal and black liquor can produce energy from papermaking
3. American Society for Microbiology honors Jason T. Blackard
4. University of Minnesota study refutes belief that black men have more aggressive prostate cancer
5. NOAA proposes federal regulations to protect black abalone
6. Black carbon pollution emerges as major player in global warming
7. Wiley-Blackwell to launch Journal of Flood Risk Management
8. BIO-key(R) Showcasing Public Safety Solutions for BlackBerry Smartphones at 2008 LEIM Conference
9. The cormorant -- the black plague or an example of successful species conservation?
10. Known genetic risk for Alzheimers in whites also places blacks at risk
11. UCF professor develops vaccine to protect against black plague bioterror attack
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
Black rat does not bother Mediterranean seabirds
(Date:6/18/2013)... Kingdom, the Energy Department,s National Renewable Energy Laboratory ... published a paper describing a novel cellulose-degrading enzyme ... , commonly known as the gribble. , ... relatively unique ability to produce their own enzymes ... the biomass they eat. New biomass-degrading enzymes from ...
(Date:6/18/2013)... not a hacker lab. At Brandeis University, sophisticated ... are helping scientists understand the complex interplay between ... the virus, outer "shell" critical for replication. ... what we are finding will help researchers alter ... post-doctoral fellow Jason Perlmutter, first author of the ...
(Date:6/18/2013)... Torrent, Ph.D., Medical Research Council, Laboratory of Molecular ... a 2013 ICAAC Young Investigator Award. Torrent is ... developing the first algorithm to predict antimicrobial regions ... said, "we are now applying this algorithm to ... antimicrobial peptide leads with very appealing results." ...
Breaking Biology News(10 mins):Novel enzyme from tiny gribble could prove a boon for biofuels research 2Computer modeling technique goes viral at Brandeis 2The American Society for Microbiology honors Marc Torrent 2
... could help ships sailing smoothly. The growth of marine ... major cause of increased energy costs in the naval ... this so called 'bio-fouling'. , Ralph Liedert from the ... work on the application of artificial shark skin in ...
... that provides a vital passage through a bacterium's outer ... is built of the 'wrong' material, scientists at The ... a finding that has long-term implications for understanding diseases ... disease, and mad cow disease. , The paper in ...
... of different items by scanning the tiny barcode printed ... could make it just as easy to identify genes, ... tagging them with color-coded probes made out of synthetic ... Luo, Cornell assistant professor of biological engineering, has created ...
Cached Biology News:Beyond genes: Lipid helps cell wall protein fold into proper shape 2Beyond genes: Lipid helps cell wall protein fold into proper shape 3Tagging pathogens with synthetic DNA 'barcodes' 2Tagging pathogens with synthetic DNA 'barcodes' 3
(Date:6/18/2013)... WILMINGTON, Delaware , June 18, 2013 /PRNewswire/ ... to announce the release of the HELM biomolecular ... permissive open source MIT licence. HELM ... of a wide range of biomolecules (e.g. proteins, ... render existing small-molecule and sequence-based informatics methodologies impractical ...
(Date:6/18/2013)... -- The "Bioinformatics Market By Sector (Molecular Medicine, Agriculture, ... Data Analysis Services) & Application (Genomics, Proteomics & Drug Design) - Global ... Restraints, and Opportunities in North America , ... and Rest of World. Browse , ... Figures 364 Pages and an in-depth ...
(Date:6/18/2013)... , June 18, 2013 ... ) has announced the addition of the ... and Companies " to their offering. ... report briefly reviews basics of human genome ... applications. Current large and small sequencers are ...
(Date:6/18/2013)... DUBLIN , June 18, 2013 ... Markets ( http://www.researchandmarkets.com/research/cmbgcv/north_american ) has announced ... American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes ... Radiation Therapy (I131, Y-90)], [Applications (Cancer/Oncology, ... to 2017" report to their ...
Breaking Biology Technology:The Pistoia Alliance Releases HELM Biomolecular Representation Standard Open Source Tools 2Bioinformatics Market Worth $7.5 Billion by 2017 2Bioinformatics Market Worth $7.5 Billion by 2017 3DNA Sequencing: Technologies, Markets and Companies - 2013 Report 2North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017 2North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017 3
... that allow nanoparticles to assemble themselves into designer materials ... of Iowa State University and the Ames Laboratory reports ... Science . Travesset, an associate professor of physics ... of Energy,s Ames Laboratory, writes in the journal,s Perspectives ...
... today announced that Jeff Liter has been appointed as ... "Jeff,s diverse background in all aspects of corporate development ... Said Matt McManus, President and CEO, PrimeraDx.  "PrimeraDx,s strategy ... Plex system in the MDx market and define ...
... from the Faculty of Biology and Biotechnology at the ... of Biological Chemistry explaining why enzymes used for ... In collaboration with researchers from Berlin, they used spectroscopic ... that lead to the inactivation of the enzyme,s iron ...
Cached Biology Technology:Iowa State, Ames Lab physicist says nanoparticle assembly is like building with LEGOs 2PrimeraDx Appoints Jeff Liter as VP of Corporate Development 2If oxygen becomes the undoing of proteins 2
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...
... The user-friendly Eppendorf Thermomixer R offers ... that require shaking, heating, and cooling. ... expanded its application and temperature control ... each accommodate 24 micro test tubes, ...
...
Biology Products: