Navigation Links
Biomedical bleeding affects horseshoe crab behavior
Date:2/24/2014

DURHAM, N.H. New research from Plymouth State University and the University of New Hampshire indicates that collecting and bleeding horseshoe crabs for biomedical purposes causes short-term changes in their behavior and physiology that could exacerbate the crabs' population decline in parts of the east coast.

Each year, the U.S. biomedical industry harvests the blue blood from almost half a million living horseshoe crabs for use in pharmaceuticals most notably, a product called Limulus amebocyte lysate (LAL), used to ensure vaccines and medical equipment are free of bacterial contamination. This lifesaving product can only be made from horseshoe crab blood, says researcher Win Watson, UNH professor of zoology.

"The crabs are very heavily bled about 30 percent or more of their blood is taken, and that's a fair amount," says Chris Chabot, professor of neurobiology at PSU and a co-author on the study. "Approximately 20 to 30 percent of those crabs do not survive, so we were curious if any of the surviving crabs experienced nearly lethal effects from the bleeding," he said.

The study, "Sublethal Behavioral and Physiological Effects of the Biomedical Bleeding Process on the American Horseshoe Crab," was published recently in the journal The Biological Bulletin.

With funding provided by a N.H. Sea Grant development grant, Chabot, Watson and lead author Rebecca Anderson, a PSU graduate student, replicated the biomedical bleeding process to determine the potential impacts on the crabs' behavior.

After capturing the crabs in New Hampshire's Great Bay and transporting some of them back to Chabot's lab at PSU and others to UNH's Jackson Estuarine Laboratory, the researchers monitored their movements for a week and then harvested some of their blood. Electronic data recorders called accelerometers that measure the crabs' speed and direction were strapped to their backs and the crabs were placed in running whee
'/>"/>

Contact: Rebecca Zeiber
rebecca.zeiber@unh.edu
603-862-6704
University of New Hampshire
Source:Eurekalert  

Page: 1 2 3

Related biology news :

1. Johns Hopkins researcher awarded prestigious Wiley Prize in Biomedical Sciences
2. LSU receives $2 million from NIH for biomedical sciences training for underrepresented students
3. UCSB biomedical scientist discovers a new method to increase survival in sepsis
4. Biomedical Advanced Research and Development Authority (BARDA) Exercises Option with Pfenex Inc. To Extend Contract and Increase Funding for the Development of a Recombinant Protective Antigen (rPA) Based Anthrax Vaccine
5. NIH announces awards to strengthen the biomedical research workforce
6. MARC travel awards announced for the 2013 Biomedical Engineering Society annual meeting
7. TGen President Dr. Jeffrey Trent speaks at Brookings Institution biomedical conference
8. Fluke Biomedical launches portable, feature-rich ProSim 3 and 2 Vital Signs Simulators
9. Biomedical research revealing secrets of cell behavior
10. New FASEB analysis documents impact of budget cuts on biomedical research
11. Core for Life, a new European alliance in biomedical research
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
Biomedical bleeding affects horseshoe crab behavior
(Date:9/16/2014)... to make ethical choices such as buying clothing not ... fair-trade coffee, and bringing their own bags when they ... Journal of Consumer Research , ethical consumption is ... emotions about unethical practices into action. , "Advocates of ... and human costs of the products they choose, but ...
(Date:9/16/2014)... practically all vital functions in an organism. For ... particular substances and control immune system responses. Researchers ... function independently of each other, but instead form ... networks, you find many similarities with online social ... of Plant Systems Biology. "Some proteins are good ...
(Date:9/16/2014)... , Sept. 16, 2014  Cross Match Technologies, ... solutions, announced today the launch of its Verifier ... the identity of an individual using their secure ... Sentry rapidly reads credential documents with embedded biometric ... matching the biometric to a live scan of ...
Breaking Biology News(10 mins):Why are consumers willing to spend more money on ethical products? 2Good networkers make prime targets 2Cross Match Launches New Identity Management Handheld Solution 2
... Children's Hospital of Philadelphia leads a multi-center $6.7 million ... of Mental Health (NIMH) to explore a novel approach ... studies and clinical trials in adult patients, the new ... human immunodeficiency virus: sites on immune cells known as ...
... found Envisat's MERIS sensor can detect coral bleaching ... could potentially monitor impacted coral reefs worldwide on ... symbiotic algae living in symbiosis with living coral ... expelled. The whitening coral may die with subsequent ...
... what happens in cells is the work of machines that ... human and other genomes, researchers now have a nearly complete ... manual telling where all the pieces go. A new study ... to answer this question for some of the smallest and ...
Cached Biology News:Federal grant funds research on novel HIV therapy 2Federal grant funds research on novel HIV therapy 3Health of coral reefs detected from orbit 2Many needles, many haystacks 2
(Date:9/16/2014)... Valley, Arizona (PRWEB) September 16, 2014 ... that develops safe and effective products to treat ... the use of a proprietary SPACEā„¢ Technology Platform ... Officer and President will present at the White ... 2014 at the Hyatt Regency Phoenix. In ...
(Date:9/16/2014)... , Sept. 16, 2014  Ascendis Pharma ... TransCon technology to address significant unmet medical needs, ... Phase 2 pediatric study to evaluate once-weekly TransCon ... or GHD.  The full interim results will be ... GRS and IGF Society, being held October 15-18, ...
(Date:9/16/2014)... According to Jeff Howell, Partner of Nidea ... new development in Downtown Toronto is expanding at a ... 755 storeys of new development last week (including three ... dominating the Toronto skyline for the foreseeable future in ... for new development. , As the Toronto city council ...
(Date:9/15/2014)... GREENBELT, Md. , Sept. 15, 2014 /PRNewswire/ ... a leading innovator of scientific products and services ... government-wide One Acquisition Solution for Integrated Services (OASIS) ... Service (FAS). GST was selected to provide the ... in the Small Business (SB) category in Pool ...
Breaking Biology Technology:Convoy Therapeutics to Present at WhiteHat Investor Conference September 18, 2014 2Convoy Therapeutics to Present at WhiteHat Investor Conference September 18, 2014 3Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 2Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 3Ascendis Pharma A/S Announces Positive Interim Results from a Phase 2 Pediatric Study of Once-Weekly TransCon Growth Hormone for the Treatment of Growth Hormone Deficiency 4ITRA Global Reports Downtown Toronto Real Estate Development is in High Gear 2ITRA Global Reports Downtown Toronto Real Estate Development is in High Gear 3Global Science & Technology, Inc. Awarded GSA OASIS Small Business Contract 2Global Science & Technology, Inc. Awarded GSA OASIS Small Business Contract 3
... HUBBARD, Ohio, Sept. 24 /PRNewswire-Firstcall/ -- NanoLogix, Inc. ... an exhibitor and,participant in the "Energy from Biomass ... David L. Lawrence Convention,Center in Pittsburgh, Pennsylvania September ... NanoLogix booth at the Expo, with,Dana Allen, Bret ...
... Seasoned leader brings added expertise to Shire ... England, Sept. 24, Shire plc (LSE: SHP, ... company, announced today that Sylvie,Gregoire has been ... (HGT),business, effective immediately. Sylvie brings more than ...
... BioCryst,Pharmaceuticals, Inc. (Nasdaq: BCRX ) today ... Life Sciences Conference in New York. A live ... 2007 at 2:00 p.m. Eastern,Time may be accessed ... will be archived for seven days. (Logo: ...
Cached Biology Technology:NanoLogix Inc. to Present at EBW Expo & Conference 2007 2Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 2Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 3Shire Appoints Sylvie Gregoire President of Human Genetic Therapies Business 4BioCryst to Present at UBS 2007 Global Life Sciences Conference 2BioCryst to Present at UBS 2007 Global Life Sciences Conference 3
... Knockout System provides optimized reagents and protocols ... bacterial genes by insertion of group II ... of group II introns and utilizes a ... group II intron for specific insertion into ...
... monoclonal antibody raised against a partial recombinant MAK. ... a.a. ~ 457 a.a) partial recombinant protein with ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
...
Mouse polyclonal antibody raised against a partial recombinant DDEF2. NCBI Entrez Gene ID = 8853...
Biology Products: