Navigation Links
BioScience tip sheet, January 2009
Date:1/1/2009

pele. The Okavango Delta, Botswana, is a major wetland surrounded by the Kalahari Desert. The delta supports a diverse fish fauna that depends not only on seasonal flooding from inflowing rivers, but also on the actions of ecosystem engineers. Understanding this complexity can help allocate water within the Okavango watershed.

Spurious Certainty: How Ignoring Measurement Error and Environmental Heterogeneity May Contribute to Environmental Consequences. Reinette Biggs, Stephen R. Carpenter, and William A. Brock. Environmental studies that appear to provide conflicting results can often be reconciled through the use of hierarchical Bayesian techniques. Such techniques can lead to a more accurate understanding of complex systems.

A Framework for Implementing Biodiversity Offsets: Selecting Sites and Determining Scale. Joseph A Kiesecker, Holly Copeland, Amy Pocewicz, Nate Nibbelink, Bruce McKenney, John Dahlke, Matt Holloran, and Dan Stroud. Selecting sites for biodiversity offsets, which seek to ensure that environmental impacts of development are balanced by environmental gains, provides conceptual and methodological challenges. The authors demonstrate the use of the Marxan site-selection algorithm in this process.


'/>"/>

Contact: Jennifer Williams
jwiliams@aibs.org
202-628-1500 x209
American Institute of Biological Sciences
Source:Eurekalert

0

GOOD

Page: 1 2

Related biology news :

1. BioScience tip sheet, December 2008
2. Energy Biosciences Institue named "Deal of Distinction" by tech-transfer group
3. BioScience tip sheet, November 2008
4. BioScience tip sheet, October 2008
5. BioScience tip sheet, September 2008
6. BioScience tip sheet July/August 2008
7. Elsevier launches Bioscience Hypotheses
8. Sangamo BioSciences to Present at the Bank of America 2008 Healthcare Conference
9. Undergraduate bioscience research reaches new horizons
10. Media highlights in the January issues of Biophysical Journal
11. Mayo Clinic Proceedings January tip sheet
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/16/2009)... of microfossils found in ocean sediment cores is illuminating ... a critical period of Earth history. , Around 55 ... epoch, the Earth,s poles are believed to have been ... 25 million years later, ice sheets covered Antarctica and ... change from greenhouse to icehouse conditions resulted from decreasing ...
(Date:12/16/2009)... DC US Secretary of Energy Steven Chu announced ... for their outstanding contributions in research and development supporting ... six winners named today will receive a gold medal, ... honored at a ceremony in Washington, DC early next ... the national, economic and energy security of the United ...
(Date:12/16/2009)... get psyched up for contests, but when these rituals ... down before and during events, they could be causing ... for the symptoms of an injury, not the injury ... focuses on musculoskeletal health and sports medicine. "They may ... certain level, but pain occurs for a reason. It ...
Breaking Biology News(10 mins):From greenhouse to icehouse -- reconstructing the environment of the Voring Plateau 2Secretary Chu announces 2009 Ernest Orlando Lawrence Award winners 2NSAIDs: Take 'em early and often when competing? Think again 2Neuropathic pain 3A The sea provides a new hope of relief 9475 1Neuropathic pain 3A The sea provides a new hope of relief 9475 2100+ Nurses to Rally in SF Wed to Demand Stronger Swine Flu Safety Protections 3A California Hospitals Remain Unprepared Despite First Nurse Death 53680 1100+ Nurses to Rally in SF Wed to Demand Stronger Swine Flu Safety Protections 3A California Hospitals Remain Unprepared Despite First Nurse Death 53680 2100+ Nurses to Rally in SF Wed to Demand Stronger Swine Flu Safety Protections 3A California Hospitals Remain Unprepared Despite First Nurse Death 53680 3Pharmacy Compounds Liquid Mupirocin for the Chronic Sinusitis Patient 13365 1Pharmacy Compounds Liquid Mupirocin for the Chronic Sinusitis Patient 13365 2
... SAN FRANCISCO, CA June 16, 2008 --- iZumi ... independent non-profit biomedical research organization, have announced a major ... for induced pluripotent stem (iPS) cells. , iPS ... and potential to those of human embryonic stem (ES) ...
... 2008, BETHESDA, MD The March of Dimes has ... and will work to address preterm birth globally. The ... of Preterm Birth, supports the national action plan being ... growing crisis of preterm birth. , "The March of ...
... Old muscle got a shot of youthful vigor in a ... Berkeley, setting the path for research on new treatments for ... Parkinson,s diseases. , In a new study to be published ... Nature , researchers identified two key regulatory pathways that ...
Other Biology News:March of Dimes announces Prematurity Campaign expansion at Surgeon General's conference 2March of Dimes announces Prematurity Campaign expansion at Surgeon General's conference 3Stem cell researchers give old muscle new pep 2Stem cell researchers give old muscle new pep 3Stem cell researchers give old muscle new pep 4
(Date:12/17/2009)... Rx Club, the Daveys, the GLOBALS, ,and PM360 Pharma Choice ... ... 17, 2009 -- Chicago-based full-service healthcare communications agency Goble & ... awards programs honoring exceptional creative and interactive work. , , ... with 9 Awards of Excellence for the following creative work: ...
(Date:12/16/2009)... cheap, accurate test to find undetected landmines. , Students ... bacteria that glows green when it comes into contact ... can be mixed into a colourless solution that, when ... indicate the presence of landmines. , Researchers say ... be delivered from the air onto areas thought to ...
(Date:12/16/2009)... Technological University (NTU) signed the Memorandum of Understanding ... Research (CNRS) and the Thales Group of Companies ... three parties are meeting again in Singapore to ... NTU. , Located at the Research Techno ... latest in science and technology to develop innovations ...
(Date:12/16/2009)... microgears in suspended solution by swimming , ... ... Scientists at the U.S. Department of Energy’s (DOE) Argonne National ... bacteria can turn microgears when suspended in a solution, providing ... , , ,“The gears are a million times more massive ...
Breaking Biology Technology:Goble & Associates Creative Work Awarded at Advertising Industry Competitions 2Goble & Associates Creative Work Awarded at Advertising Industry Competitions 3Goble & Associates Creative Work Awarded at Advertising Industry Competitions 4New Singapore-French nanotech lab opens at NTU 2New Singapore-French nanotech lab opens at NTU 3Argonne Scientists Use Bacteria to Power Simple Machines 2Argonne Scientists Use Bacteria to Power Simple Machines 3
... CHICAGO, Dec. 14 Non-surgical, spinal decompression is,probably ... need. And you can,forget about popping toxic pills, ... this amazing technology - for most people - ... Thea Flock is Chicagoland,s most respected authority on ...
... 13 Give the person on your list who,has ... of a Magical Mystical,Pen by world-renowned artist, Karen Sperling., ... Magical Mystical Tour,abstracts, currently exhibited in the Digital Long ... in St. James, NY, through,January 11, 2008., "Karen ...
... presented at San Antonio Breast Cancer Symposium, ... in the rapidly evolving field of molecular diagnostics, ... the,prognostic power of its MammaPrint(R) breast cancer prognosis ... The data show that,MammaPrint(R) can accurately identify a ...
Other Biology Technology:Amazing Treatment Relieves Serious Back Pain Without Dangerous Drugs, Injections or Surgery! 2Artistic Magical Mystical Tours 2MammaPrint(R) Breast Cancer Test Validated in Lymph Node-Positive Breast Cancer Patients 2MammaPrint(R) Breast Cancer Test Validated in Lymph Node-Positive Breast Cancer Patients 3
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... The BD PhosFlow Perm/Wash Buffer I can ... modified signaling proteins to permeabilize cells and ... cell wash buffer. Because saponin-mediated cell permeabilization ... to keep the cells in the presence ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Biology Products: