Navigation Links
Ben-Gurion University of the Negev professor awarded the 2010 Elkeles Prize for Cancer Research
Date:8/8/2010

BEER-SHEVA, ISRAEL, August 9, 2010 Ben-Gurion University of the Negev (BGU) Professor Ron N. Apte has been awarded the 2010 Samuel and Paula Elkeles Prize for Outstanding Scientist in the Field of Medicine.

Professor Apte is chairman of the Shraga Segal Department of Microbiology and Immunology and vice dean of the Basic Sciences division in the BGU Faculty of Health Sciences. He is also the Irving Sklar Chair in Endocrinology and Cancer and a member of the National Institute for Biotechnology in the Negev.

Apte's major field of research involves inflammation in malignant processes. Approximately 15 percent of cancers are connected to inflammation, which typically result in organs where chronic inflammation has occurred. For example, patients with Inflammatory Bowel Disease (IBD) are more prone to cancer than the general population.

The pioneering studies of Apte's group demonstrated the feasibility of intervening in malignant process by neutralizing inflammatory components in the "normal" microenvironment of a tumor. They also detailed the basic concepts underlying such treatment.

Inflammatory cells affect proliferation and invasiveness of malignant cells through the secretion of cytokines, which include Interleukin-1 (IL-1), the molecule that has been studied for years by Apte's group. The group has demonstrated the involvement of IL-1-mediated inflammation in tumor invasiveness and metastasis. IL-1 causes tumor expansion because it suppresses the immune system and nourishes a tumor's blood vessels. Apte's group treated tumor-bearing mice with a specific inhibitor of IL-1, known as the IL-1 receptor antagonist (IL-Ra), and succeeded in weakening the tumor's invasiveness.

IL-Ra, in its generic form Anakirna, is a medication that efficiently alleviates symptoms of patients suffering from rheumatoid arthritis, a chronic inflammatory disease.

Apte joined the BGU Faculty of Sciences in 1981 and has se
'/>"/>

Contact: Andrew Lavin
andrewlavin@alavin.com
516-353-2505
American Associates, Ben-Gurion University of the Negev
Source:Eurekalert

Page: 1 2

Related biology news :

1. Ben-Gurion University of the Negev researchers identify risks of hypertension in young adults
2. FDA approves trial for type 1 diabetes treatment by Ben-Gurion U. and U. Colorado
3. Ben-Gurion U researchers isolate microalgal strain that could reduce cholesterol
4. Uniform method to interpret autism spectrum disorders is defined at Ben-Gurion University
5. Anti-inflammatory drugs (coxibs) interfere with aspirins clotting ability -- Ben-Gurion U.
6. Heartburn drugs deemed safe for fetuses according to Ben-Gurion University researchers
7. Ben-Gurion University Alzheimers researcher demonstrates specific immune response to vaccine
8. Ben-Gurion University of the Negev technology being developed for use in Jordan desalination plant
9. Ben-Gurion U. developing new computer techniques to analyze historic Hebrew and Arabic documents
10. 1 in 6 health workers wont report in flu pandemic -- study by Ben-Gurion U. researchers
11. Ben-Gurion U. researchers reveal connection between cancer and human evolution
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/18/2013)... Kingdom, the Energy Department,s National Renewable Energy Laboratory ... published a paper describing a novel cellulose-degrading enzyme ... , commonly known as the gribble. , ... relatively unique ability to produce their own enzymes ... the biomass they eat. New biomass-degrading enzymes from ...
(Date:6/18/2013)... not a hacker lab. At Brandeis University, sophisticated ... are helping scientists understand the complex interplay between ... the virus, outer "shell" critical for replication. ... what we are finding will help researchers alter ... post-doctoral fellow Jason Perlmutter, first author of the ...
(Date:6/18/2013)... Torrent, Ph.D., Medical Research Council, Laboratory of Molecular ... a 2013 ICAAC Young Investigator Award. Torrent is ... developing the first algorithm to predict antimicrobial regions ... said, "we are now applying this algorithm to ... antimicrobial peptide leads with very appealing results." ...
Breaking Biology News(10 mins):Novel enzyme from tiny gribble could prove a boon for biofuels research 2Computer modeling technique goes viral at Brandeis 2The American Society for Microbiology honors Marc Torrent 2
... could help ships sailing smoothly. The growth of marine ... major cause of increased energy costs in the naval ... this so called 'bio-fouling'. , Ralph Liedert from the ... work on the application of artificial shark skin in ...
... that provides a vital passage through a bacterium's outer ... is built of the 'wrong' material, scientists at The ... a finding that has long-term implications for understanding diseases ... disease, and mad cow disease. , The paper in ...
... of different items by scanning the tiny barcode printed ... could make it just as easy to identify genes, ... tagging them with color-coded probes made out of synthetic ... Luo, Cornell assistant professor of biological engineering, has created ...
Cached Biology News:Beyond genes: Lipid helps cell wall protein fold into proper shape 2Beyond genes: Lipid helps cell wall protein fold into proper shape 3Tagging pathogens with synthetic DNA 'barcodes' 2Tagging pathogens with synthetic DNA 'barcodes' 3
(Date:6/18/2013)... WILMINGTON, Delaware , June 18, 2013 /PRNewswire/ ... to announce the release of the HELM biomolecular ... permissive open source MIT licence. HELM ... of a wide range of biomolecules (e.g. proteins, ... render existing small-molecule and sequence-based informatics methodologies impractical ...
(Date:6/18/2013)... -- The "Bioinformatics Market By Sector (Molecular Medicine, Agriculture, ... Data Analysis Services) & Application (Genomics, Proteomics & Drug Design) - Global ... Restraints, and Opportunities in North America , ... and Rest of World. Browse , ... Figures 364 Pages and an in-depth ...
(Date:6/18/2013)... , June 18, 2013 ... ) has announced the addition of the ... and Companies " to their offering. ... report briefly reviews basics of human genome ... applications. Current large and small sequencers are ...
(Date:6/18/2013)... DUBLIN , June 18, 2013 ... Markets ( http://www.researchandmarkets.com/research/cmbgcv/north_american ) has announced ... American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes ... Radiation Therapy (I131, Y-90)], [Applications (Cancer/Oncology, ... to 2017" report to their ...
Breaking Biology Technology:The Pistoia Alliance Releases HELM Biomolecular Representation Standard Open Source Tools 2Bioinformatics Market Worth $7.5 Billion by 2017 2Bioinformatics Market Worth $7.5 Billion by 2017 3DNA Sequencing: Technologies, Markets and Companies - 2013 Report 2North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017 2North American Nuclear Medicine/Radiopharmaceuticals & Stable Isotopes Market - Forecast to 2017 3
... that allow nanoparticles to assemble themselves into designer materials ... of Iowa State University and the Ames Laboratory reports ... Science . Travesset, an associate professor of physics ... of Energy,s Ames Laboratory, writes in the journal,s Perspectives ...
... today announced that Jeff Liter has been appointed as ... "Jeff,s diverse background in all aspects of corporate development ... Said Matt McManus, President and CEO, PrimeraDx.  "PrimeraDx,s strategy ... Plex system in the MDx market and define ...
... from the Faculty of Biology and Biotechnology at the ... of Biological Chemistry explaining why enzymes used for ... In collaboration with researchers from Berlin, they used spectroscopic ... that lead to the inactivation of the enzyme,s iron ...
Cached Biology Technology:Iowa State, Ames Lab physicist says nanoparticle assembly is like building with LEGOs 2PrimeraDx Appoints Jeff Liter as VP of Corporate Development 2If oxygen becomes the undoing of proteins 2
... Mouse monoclonal antibody raised against a partial recombinant ... 56 a.a. ~ 145 a.a) partial recombinant protein ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
Mouse monoclonal antibody raised against a partial recombinant PRKG1. NCBI Entrez Gene ID = PRKG1...
... The user-friendly Eppendorf Thermomixer R offers ... that require shaking, heating, and cooling. ... expanded its application and temperature control ... each accommodate 24 micro test tubes, ...
...
Biology Products: