Navigation Links
BGI partners with Life Technologies to offer sequencing applications on ion torrent
Date:10/21/2013

CARLSBAD, Calif., and Shenzhen, China, October 21, 2013 -- Life Technologies Corporation (NASDAQ: LIFE) and BGI, the world's largest genomics center and service provider, jointly announced that BGI has purchased 38 Ion Proton Sequencers and plans to add at least a dozen more by the end of the year, strengthening the organization's leadership position in the genomics industry. BGI also signed a supply and licensing agreement with Life Technologies, further enhancing BGI's ability to perform basic, agricultural and clinical research.

The addition of the Ion Torrent to BGI's current broad array of technology platforms will facilitate its goal of accelerating and expanding the organization's strong presence in all areas of next-generation sequencing and clinical research, ranging from exome and transcriptome sequencing to aneuploidy testing to whole genome analysis.

BGI has already validated the Ion Proton System in several applications. The Ion Proton Sequencer has consistently delivered over 80 million high-quality sequencing reads in 2-3 hour sequencing runs on the Ion PI Chip in BGI's labs.

"We have been working with the Ion Proton platform on major applications for the last several months and it has passed every test," said Jun Wang, director of BGI. "It is flexible and affordable, so we can quickly deploy it in many satellite labs around the world for all applications. The Ion Proton is also very fast, enabling us to provide our customers and partners results in days, not weeks, which is extremely important for clinical research applications. The upcoming Ion PII Chip is expected to significantly expand sequencing capacity on the same Ion Proton Sequencer and our plan is to migrate additional applications to the Ion Proton platform."

"BGI's commitment to the Ion Proton platform is the ultimate validation that our breakthrough benchtop sequencing technology delivers more value than the big sequencers that have dominated t
'/>"/>

Contact: Jia Liu
liujia@genomics.cn
BGI Shenzhen
Source:Eurekalert

Page: 1 2

Related biology news :

1. Medbox Partners with Licensed Medical Cannabis Laboratory and Cultivation Center in Canada
2. BioForce Nanosciences, Inc. Expands Its Global Market. New partnership with Acugenex Limited
3. Genetics Society of America joins editorial partnership for CBE-Life Sciences Education
4. 4 projects awarded Discovery Transformation Grant funding by Minnesota Partnership
5. Newly discovered bacterial partnership changes ocean chemistry
6. Transatlantic partnership to tackle neurodegenerative disease
7. Advance Research Associates Partners With MedNet Solutions
8. NOAA, partners predict possible record-setting deadzone for Gulf of Mexico
9. The DOE Joint Genome Institute expands capabilities via new partnerships
10. TGen and Riddell announce partnership for biomarker study of concussive injuries
11. Capco Partners with EyeLock to Bring Iris Biometric Security to Banks
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/23/2015)... , June 23, 2015   MedNet Solutions ... supports the entire spectrum of clinical research, is ... ™ , the company,s intuitive, flexible and ... a Silver 2015 Stevie® Award by the ... & Services Website category.  The American Business Awards ...
(Date:6/23/2015)... June 23, 2015  Crossmatch™, a leading ... today announced enhanced functionality of its DigitalPersona ... The enhancements build on the native flexibility ... Altus platform and provide expanded mobile credential ... In today,s environment of increasing cyber-attacks and ...
(Date:6/17/2015)... GERMANTOWN, Maryland , June 17, 2015 ...   Produktlinie mit DNA-Tests verbessert den Analyseprozess und ... QGEN ; Frankfurt Prime Standard: QIA) hat heute in ... Produktlinie Investigator ® für ... Die neuen Kits zur Erstellung genetischer Fingerabdrücke bieten eine ...
Breaking Biology News(10 mins):MedNet Solutions' iMedNet eClinical Wins Silver Stevie Award 2Crossmatch Releases Enhanced DigitalPersona Altus Advanced Authentication Functionality 2QIAGEN bringt in den USA neue Kits für die forensische DNA-Analyse auf den Markt 2QIAGEN bringt in den USA neue Kits für die forensische DNA-Analyse auf den Markt 3QIAGEN bringt in den USA neue Kits für die forensische DNA-Analyse auf den Markt 4QIAGEN bringt in den USA neue Kits für die forensische DNA-Analyse auf den Markt 5QIAGEN bringt in den USA neue Kits für die forensische DNA-Analyse auf den Markt 6
... A study at the University of Leeds has shown, ... and swim using the same gait, overturning the widely ... The findings have important implications for biologists and ... Until recently scientists have largely limited their observations of ...
... Saenz, MD, a Medical Genetics Fellow at The Children,s ... recipient of the Genzyme/American College of Medical Genetics Foundation ... ACMG 2009 Annual Clinical Genetics Meeting in Tampa, FL. ... support a national fellowship program to encourage the recruitment ...
... of Medical Genetics Foundation (ACMGF) recently awarded Dr. Sihoun ... Washington School of Medicine the 2009-2010 Luminex/ACMGF Award at ... Genetics Meeting in Tampa, FL. The award includes ... of safe and effective genetic testing and services, including ...
Cached Biology News:To swim or to crawl: For the worm it's a no brainer 2
(Date:7/2/2015)... 2, 2015  Spherix Incorporated (Nasdaq: SPEX ) -- an ... monetization of intellectual property, today announced a litigation update. ... v. Verizon Services Corp. et al. , Case No. ... Eastern District of Virginia , the ... interpreting certain key claims in favor of the Defendants ...
(Date:7/1/2015)... ... July 01, 2015 , ... It is now possible ... using single photon emission computed tomography (SPECT) according to researchers from Amen ... examined over 20,000 brain scans and is believed to be the largest brain imaging ...
(Date:7/1/2015)... AURORA, Colo. and BANGALORE, India ... a global genomic profiling company that uses next generation ... appointment of Scott A. Storrer as chief ... and CEO, he will be responsible for all strategy, ... Vijay Chandru , who has served as Strand,s chairman ...
(Date:7/1/2015)... ... July 01, 2015 , ... A newly launched business plan contest ... the barriers to innovation in life sciences R&D. The Pistoia Alliance President’s Startup Challenge ... of US$15,000 and a period of expert mentorship from a senior industry figure drawn ...
Breaking Biology Technology:Spherix Issues A Litigation Update 2Spherix Issues A Litigation Update 3Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 2Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 3Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 4Strand Life Sciences Names Scott A. Storrer CEO as Company Continues Global Expansion with Focus on Precision Medicine Product 2Strand Life Sciences Names Scott A. Storrer CEO as Company Continues Global Expansion with Focus on Precision Medicine Product 3Pistoia Alliance Launches Startup Challenge 2Pistoia Alliance Launches Startup Challenge 3
... Ph.D., President, ViaGen, January 11, 2008, WASHINGTON, ... Authority,s strong endorsement of the safety of food,from clones ... Drug,Administration to release its final risk assessment at the ... international,scientific consensus is clear: food from these animals and ...
... Energy now lost as heat during the production ... of silicon nanowires synthesized via a technique developed ... (DOE) Lawrence Berkeley National Laboratory (Berkeley Lab) and ... far-ranging potential applications of this technology include DOEs ...
... HealthCare Technologies,Ltd., (the "Company") today announced that it ... Staff of the Listing Qualifications Department,(the "Staff Determination") ... because the Staff believes that the Company,s Plan ... December 31, 2007, constituted a,reverse merger, the surviving ...
Cached Biology Technology:Statement on the Release of the European Food Safety Assessment on the Safety of Food Derived From Clones and Their Offspring in the Food Supply 2Feeling the heat 2Feeling the heat 3Feeling the heat 4HealthCare Technologies Ltd. (NASDAQ: HCTL) Announces Receipt of NASDAQ Delisting Notice 2
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
... antibody raised against a partial ... Immunogen: PPP4C (NP_002711, 218 ... recombinant protein with GST tag. ... NM_002720 ...
Biology Products: