Navigation Links
As Amazon urbanizes, rural fires burn unchecked
Date:12/10/2012

Over past decades, many areas of the forested Amazon basin have become a patchwork of farms, pastures and second-growth forest as people have moved in and cleared land--but now many are moving out, in search of economic opportunities in newly booming Amazonian cities. The resulting depopulation of rural areas, along with spreading road networks and increased drought are causing more and bigger fires to ravage vast stretches, say researchers in a new study. The study, focusing on the Peruvian Amazon, is the latest to suggest that land-use changes and other factors, including possibly climate change, are driving increasingly destructive wildfires in many parts of the earth. An interdisciplinary team at Columbia University's Earth Institute will publish the paper this week in the Proceedings of the National Academy of Sciences.

Nearly all fires in the Peruvian Amazon are set by humans seeking to burn woody vegetation off pastures, clear fallow land for planting, and release nutrients back into the soilmillennia-old methods used in many parts of the world. So-called slash-and-burn agriculture got a bad name in recent decades when fast-growing numbers of tropical ranchers and farmers deforested vast areas with fire, leading to massive soil erosion and releases of carbon. With many now abandoning land or working it only part time in favor of city jobs, some scientists started thinking this might lead to fewer fires. But the study shows the opposite: with fewer people around to control fires, and flammable small trees and grasses quickly taking over uncultivated plots, more blazes are spreading out of control and burning off bigger areas--not only forests but farms, fruit plantations, homes and villages.

"Farmers are often blamed for deforestation and environmental destruction, but they are fairly sophisticated in managing firethey plan when, how and where to burn the land," said lead author Mara Uriarte, a forest ecologist in Columb
'/>"/>

Contact: Kevin Krajick
kkrajick@ei.columbia.edu
212-854-9729
The Earth Institute at Columbia University
Source:Eurekalert  

Page: 1 2 3

Related biology news :

1. Scientists reconstruct pre-Columbian human effects on the Amazon Basin
2. 800-year-old farmers could teach us how to protect the Amazon
3. Chicken and egg question (and answer) for rural Uganda
4. Pioneering self-contained smart village offers world model for rural poverty relief
5. Wildfires light up western Australia
6. Fire and ice: Wildfires darkening Greenland snowpack, increasing melting
7. Tracking invasive cheatgrass role in larger, more frequent Western fires
8. Unusual weather events identified during the Black Saturday bushfires
9. WSU researcher sees how forests thrive after fires and volcanoes
10. NASA satellites see wildfires across Colorado
11. NASA satellite sees several western US fires blazing
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
As Amazon urbanizes, rural fires burn unchecked
(Date:4/17/2014)... a novel method to help kidney stone sufferers ... treatment possible., Kidney stones represent a major medical ... left untreated, apart from being particularly painful, they ... In many patients treated successfully, stone recurrence is ... approach to diagnosis and treatment needs to be ...
(Date:4/17/2014)... whereby the genetic information of DNA is used ... have numerous different functions in living organisms. Messenger ... gene expression, by relating the genetic information of ... proteins. , By examining the different types ... organism at a given time, researchers can determine ...
(Date:4/17/2014)... View of Domestication," a special feature of The ... ( PNAS ) published April 29, raises a ... deep history that most of us take for granted. ... in many spots around the globe shifted from hunting ... and plants. , It seems so straightforward and yet ...
Breaking Biology News(10 mins):Rapid and accurate mRNA detection in plant tissues 2Genetic study tackles mystery of slow plant domestications 2Genetic study tackles mystery of slow plant domestications 3Genetic study tackles mystery of slow plant domestications 4
... NYJuly 28, 2011A new study co-authored by Columbia Engineering ... Environmental Science & Technology , shows that reducing ... with "sizable" economic benefits, as well as the expected ... five scientists from around the U.S. who worked on ...
... -- (July 28, 2011) -- The DNA evidence is in, ... more than 1,000 Chinese tallow trees from the United States ... the tallow trees that are overrunning thousands of acres of ... widely known that Franklin introduced tallow trees to the U.S. ...
... the Food and Drug Administration approved a drug called ... African-American patients, claiming in a press release that this ... Invention: How Science, Politics and Big Business Re-create Race ... Roberts, the Kirkland & Ellis Professor at Northwestern University ...
Cached Biology News:New study outlines economic and environmental benefits to reducing nitrogen pollution 2New study outlines economic and environmental benefits to reducing nitrogen pollution 3Genetic evidence clears Ben Franklin 2Genetic evidence clears Ben Franklin 3Divided by race 2
(Date:1/15/2014)... 15, 2014 TaiGen Biotechnology Company, Limited ("TaiGen") today ... R-Pharm, a leading Russian pharmaceutical company, to develop and ... Russian Federation , Turkey ... is a novel antibiotic for the treatment of bacterial ...
(Date:1/14/2014)... Carahsoft and CDS Federal Services have scheduled a ... EST (11am PST), “Natural Language Processing: Converting Raw Data ... can turn raw, heterogeneous data into actionable knowledge to ... webinar will last approximately one hour. , Synopsis: Big ...
(Date:1/14/2014)... , Jan. 14, 2014  3D Communications, a leading provider of strategic ... business, and media events in the United States ... associate Virginia Cox , JD, is returning to the firm,s ... Cox re-joins 3D after more than two years of service ...
(Date:1/14/2014)... 2014 EquitiesIQ, a leading informational research ... Alliqua is an emerging biomedical company acquiring, developing, manufacturing, ... market. , Free report download: http://equitiesiq.com/reports/alliqua/ , ... management team and Board, which launched the company’s new ...
Breaking Biology Technology:TaiGen Biotechnology Signed Exclusive License Agreement with R-Pharm for Nemonoxacin (Taigexyn(R)) 2TaiGen Biotechnology Signed Exclusive License Agreement with R-Pharm for Nemonoxacin (Taigexyn(R)) 3TaiGen Biotechnology Signed Exclusive License Agreement with R-Pharm for Nemonoxacin (Taigexyn(R)) 4Webcast - Natural Language Processing: Converting Raw Data into Actionable Knowledge – Hosted by Carahsoft and CDS Federal Services 2Former FDA Associate Commissioner Returns To 3D Communications 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 2EquitiesIQ Initiates Coverage of Alliqua, Inc. 3
... ... , ... Waterville, ME (Vocus) April 15, 2010 -- Cerealus Holdings, in collaboration with the ... Next Generation Strength + Retention System.” Originally patented by DuPont and later developed ...
... ... attendance at the Partec/Powtech/WCPT6 on April 26-29 in Nuremberg, Germany. Visit ... range including FBRM® C35, PVM® V819, and S400 laboratory probes. In ... three posters and one paper. FBRM® and PVM® technology will also ...
... ... reporting and ad hoc analysis , ... (PRWEB) April 13, 2010 -- Like many customer-oriented organizations, Maine Medical ... its data. The program manages behavioral healthcare for 69,000 recipients in Maine, New ...
Cached Biology Technology:Cerealus Announces Licensing Agreement for Bio-Based Ceregel™, A Next Generation Strength and Retention System 2Track Particle Distribution in Real Time 2Track Particle Distribution in Real Time 3Maine Medical Center Chooses Business Intelligence Solution from Rapid Insight Inc. 2
Mouse monoclonal antibody raised against a full length recombinant CSNK2A2. NCBI Entrez Gene ID = CSNK2A2...
... DNA Visualizer Extraction Kit is manufactured ... causing DNA damage byexposure to UV light. ... gel is often used for DNA-cloning work. ... ethidium bromide and exposure of UV light ...
... Mouse monoclonal antibody raised against a partial ... (AAH39825, 358 a.a. ~ 457 a.a) partial recombinant ... Sequence: PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: ... AAH39825 OMIM: 154235, ...
Mouse monoclonal antibody raised against a partial recombinant L3MBTL2. NCBI Entrez Gene ID = L3MBTL2...
Biology Products: