Navigation Links
Antibiotics take toll on beneficial microbes in gut
Date:6/18/2009

ANN ARBOR, Mich. It's common knowledge that a protective navy of bacteria normally floats in our intestinal tracts. Antibiotics at least temporarily disturb the normal balance. But it's unclear which antibiotics are the most disruptive, and if the full array of "good bacteria" return promptly or remain altered for some time.

In studies in mice, University of Michigan scientists have shown for the first time that two different types of antibiotics can cause moderate to wide-ranging changes in the ranks of these helpful guardians in the gut. In the case of one of the antibiotics, the armada of "good bacteria" did not recover its former diversity even many weeks after a course of antibiotics was over.

The findings could eventually lead to better choices of antibiotics to minimize side effects of diarrhea, especially in vulnerable patients. They could also aid in understanding and treating inflammatory bowel disease, which affects an estimated 500,000 to 1 million Americans, and Clostridium difficile, a growing and serious infection problem for hospitals.

Normally, a set of thousands of different kinds of microbes lives in the gut a distinctive mix for each person, and thought to be passed on from mother to baby. The microbes, including many different bacteria, aid digestion and nutrition, appear to help maintain a healthy immune system, and keep order when harmful microbes invade.

"Biodiversity is a well-known concept in the health of the world's continents and oceans. Diversity is probably important in the gut microsystem as well," says Vincent B. Young, M.D., Ph.D., senior author of the study, which appears in the June issue of Infection and Immunity.

The study results suggest that unless medical research discovers how to protect or revitalize the gut microbial community, "we may be doing long-term damage to our close friends," says Young, assistant professor in the departments of internal med
'/>"/>

Contact: Anne Rueter
arueter@umich.edu
734-764-2220
University of Michigan Health System
Source:Eurekalert  

Page: 1 2 3

Related biology news :

1. UIC researchers find promising new targets for antibiotics
2. Alternative methods proposed to detect pesticides and antibiotics in water and natural food
3. Manure management reduces levels of antibiotics and antibiotic resistance genes
4. High degree of resistance to antibiotics in Arctic birds
5. Unique fungal collection could hold key to future antibiotics
6. UIC scientists discover how some bacteria survive antibiotics
7. Class of antibiotics can enhance gene-silencing tool
8. Energy-saving bacteria resist antibiotics
9. Milk may help bacteria survive against low levels of antibiotics
10. New way to make malaria medicine also first step in finding new antibiotics
11. Groundbreaking discovery may lead to stronger antibiotics
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
Antibiotics take toll on beneficial microbes in gut
Antibiotics take toll on beneficial microbes in gut
(Date:12/3/2009)... undergo a personality change in warmer water, according to an ... species more aggressive. , Experiments with two species of young ... first time that some reef fish are either consistently timid, ... more marked as water temperatures rise. , A slight lift ...
(Date:12/3/2009)... included in the design of the upcoming forest deal at ... a scientist at the University of Leeds. , Writing ... at least 50% of the carbon credit payments to be ... and Degredation), should be made to forest dwellers directly, and ...
(Date:12/3/2009)... comes to investment in energy efficient technologies research, but ... Dave Delpy believes that more is needed: "Scientific and ... wind and solar power solutions, but more investment is ... we are to meet our carbon emission targets by ...
Breaking Biology News(10 mins):Fish with attitude: Some like it hot 2Forest deal at Copenhagen must avoid creating 'carbon refugees' 2Research is vital to a cleaner, greener, low carbon future 2Firm Says Low Cost Genome Sequencing Is Possible 60782 1Mom was right 3A Nice guys dont always finish last 60778 1Mom was right 3A Nice guys dont always finish last 60778 2DIA Conference to Explore Components of Risk Management Plans As They Apply to Medicinal Products Therapeutic Biologics and Vaccines 60773 1DIA Conference to Explore Components of Risk Management Plans As They Apply to Medicinal Products Therapeutic Biologics and Vaccines 60773 2DIA Conference to Explore Components of Risk Management Plans As They Apply to Medicinal Products Therapeutic Biologics and Vaccines 60773 3
... CA--Version 2.4 of the Integrated Microbial Genomes (IMG) data ... for microbial genome data analysis, has now been released. ... Institute (DOE JGI), IMG has built a popular following ... offered in Spring 2008, now full. DOE JGI has ...
... various plants, animals and microorganisms, Systems Biology is regarded ... research. Current technologies allow biologists to spell all the ... little in the way of deciphering this complex code. ... give them new tools for use in drug discovery ...
... the new in vitro tests, called the Standard Scrapie ... accurate and extremely rapid way, producing results in less ... Panel Assay, allows researchers to quickly distinguish between several ... assays, the scientists were able to show that four ...
Other Biology News:World class in Systems Biology is the aim 2World class in Systems Biology is the aim 3World class in Systems Biology is the aim 4Scripps scientists develop new tests that identify lethal prion strains quickly and accurately 2
(Date:12/3/2009)... Dec. 3 VIA Pharmaceuticals, Inc. (Nasdaq: VIAP ... compounds for the treatment of cardiovascular and metabolic disease, ... visit in its Phase 2 FDG-PET clinical trial of ... and was carried out at five sites in the ...
(Date:12/3/2009)... 3 Inverness Medical Innovations, Inc. (NYSE: IMA ... of their health at home through the merger of rapid ... per share on its Series B Convertible Perpetual Preferred Stock ... Series B stock in an amount per share equal to ...
(Date:12/2/2009)... COLUMBIA, Md., Dec. 2 Martek Biosciences Corporation (Nasdaq: ... results of its fourth quarter and fiscal year 2009 on ... Following the release, at 4:45 p.m. ET Martek will ... All interested parties may listen to the call live ...
(Date:12/2/2009)... Reportlinker.com announces that a new market research ... Carbondioxide Incubators - A Global Market ... ,, Incubators are the most critical equipment ... other applications for providing a controlled environment ...
Breaking Biology Technology:VIA Pharmaceuticals Completes Patient Visits in Phase 2 Trial of VIA-2291 2VIA Pharmaceuticals Completes Patient Visits in Phase 2 Trial of VIA-2291 3VIA Pharmaceuticals Completes Patient Visits in Phase 2 Trial of VIA-2291 4Martek to Announce Fourth Quarter and Fiscal Year 2009 Results 2Reportlinker Adds Carbondioxide Incubators - A Global Market Perspective 2Reportlinker Adds Carbondioxide Incubators - A Global Market Perspective 3Reportlinker Adds Carbondioxide Incubators - A Global Market Perspective 4
... Net Results Improve for Year on Higher Services ... Digirad Corporation,(Nasdaq: DRAD ), a leading ... physicians, offices, hospitals and imaging centers, today,reported narrower ... 2007, on,higher annual revenues and lower operating expenses ...
... DIEGO, Feb. 7 ADVENTRX Pharmaceuticals,Inc. (Amex: ... pharmacokinetic data from,the Company,s marketing-enabling bioequivalence clinical ... for presentation at the 2008,American Association for ... April 12 - 16, 2008 in San ...
... Neal Skipper and Franco Cacialli, of the London ... Physics & Astronomy, University College London (UCL), have ... help them develop alternative fuel supplies for transport ... grant, with funding from the Wolfson Foundation under ...
Other Biology Technology:Digirad Corporation Reports Financial Results for 2007 Fourth Quarter and Twelve Months 2Digirad Corporation Reports Financial Results for 2007 Fourth Quarter and Twelve Months 3Digirad Corporation Reports Financial Results for 2007 Fourth Quarter and Twelve Months 4Digirad Corporation Reports Financial Results for 2007 Fourth Quarter and Twelve Months 5Digirad Corporation Reports Financial Results for 2007 Fourth Quarter and Twelve Months 6Digirad Corporation Reports Financial Results for 2007 Fourth Quarter and Twelve Months 7ADVENTRX to Present Complete ANX-530 Pharmacokinetic Data at the 2008 American Association for Cancer Research Annual Meeting 2ADVENTRX to Present Complete ANX-530 Pharmacokinetic Data at the 2008 American Association for Cancer Research Annual Meeting 3New funding to charge energy research at UCL and the London Centre for Nanotechnology 2
... & SSM4, Small space saving design - ideal ... of two models: , - 3D gyratory action ... , Digital speed control and built-in timer , Optional ... rockers are ideal where gentle mixing is required, either ...
...
... Mouse monoclonal antibody raised against a partial recombinant ... 358 a.a. ~ 457 a.a) partial recombinant protein ... PPKQQSQEKPPQTLFPSIVKNMPTKPNGTLSHKSGRRRWGQTIFKSGDSWEELEDYDFGASHSKKPSMGVFKEKRKKDSPFRQQVKMAVISLSAHQFPTL Accession: BC039825 ... OMIM: 154235, ...
Mouse monoclonal antibody raised against a full length recombinant PPIL2. NCBI Entrez Gene ID = PPIL2...
Biology Products: