Navigation Links
Antibiotic offers potential for anti-cancer activity
Date:1/28/2011

INDIANAPOLIS An antibiotic known for its immunosuppressive functions could also point the way to the development of new anti-cancer agents, researchers at the Indiana University School of Medicine have reported.

The study determined that the compound, tautomycetin, targets an enzyme called SHP2, which plays an important role in cell activities such as proliferation and differentiation. Interestingly, SHP2 mutations are also known to cause several types of leukemia and solid tumors. The findings were reported in the Jan. 28, 2011, issue of the journal Chemistry and Biology.

The potential for developing anti-cancer agents grew out of an attempt to determine how the compound, tautomycetin, exerts its immune suppression activities, said Zhong-Yin Zhang, Ph.D., Robert A. Harris Professor and chairman of the Department of Biochemistry and Molecular Biology.

The finding is also encouraging because SHP2 is a member of a large family of enzymes called protein tyrosine phosphotases (PTPs), which are important in the signaling processes that control all essential cellular functions. Dysregulation of PTP activity has been linked to several human diseases, including cancer, diabetes, and immune dysfunctions. But their makeup has made it difficult to find potential drugs to act on them, characteristics that have labeled the PTPs as "undruggable," Dr. Zhang said.

"So we have identified a lead a natural product produced by the bacteria Streptomyces that should serve as a foundation for the development of therapeutic agents for a large family of protein tyrosine phosphotase targets. Until now these targets, including SHP2 for leukemia and other cancers, have been deemed undruggable," he said.


'/>"/>

Contact: Eric Schoch
eschoch@iupui.edu
317-274-7722
Indiana University School of Medicine
Source:Eurekalert

Page: 1

Related biology news :

1. Common antibiotics and blood pressure medication may result in hospitalization
2. Virginia Tech engineer identifies new concerns for antibiotic resistance, pollution
3. University of Minnesota engineering researcher finds new way to fight antibiotic-resistant bacteria
4. Antibiotics have long-term impacts on gut flora
5. FSU researchers examine how bacteria become resistant to antibiotics
6. Antibiotic appears safe for stroke patients and good companion for tPA
7. Cockroach brains could be rich stores of new antibiotics
8. Insect brains are rich stores of new antibiotics
9. Ancient brew masters tapped antibiotic secrets
10. Ants found to use multiple antibiotics as weed killers
11. Antibiotic may reduce stroke risk and injury in diabetics
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:3/20/2015)... , Mar. 20, 2015 Research and Markets ... addition of the "India Sensors Market Forecast ... The sensor market is projected to ... Consumer electronics, automotive, industrial and healthcare ... in the country. In addition, adoption of MEMS ...
(Date:3/19/2015)... Conn. , March 19, 2015  NXT-ID, Inc. (NASDAQ: ... authentication company focused on the growing mobile commerce market, announces ... in a news clip that aired this week on ... ) . In a segment "The Next Great ... wallet ,a new way to pay, and ,a really big ...
(Date:3/17/2015)...  MecklerMedia Corporation (OTCQX: MECK) announced its ... ever held in New York City ... 2015 at the Javits Convention Center. ... Acorn Product Development; Axis NJ; c-Link Systems; CoroWare; ... NewBotic Corporation; Neya Systems LLC; Reliabotics; RoboKind; RocketFarm ...
Breaking Biology News(10 mins):India Sensors Market Forecast and Opportunities 2020 - STMicroelectronics held the largest share in 2014 2India Sensors Market Forecast and Opportunities 2020 - STMicroelectronics held the largest share in 2014 3NXT-ID's Wocket Smart Wallet Featured on Fox News Segment, "The Next Great Thing" 2NXT-ID's Wocket Smart Wallet Featured on Fox News Segment, "The Next Great Thing" 3MecklerMedia's RoboUniverse New York Announces Sponsors and Exhibitors, May 11-13, 2015 2
... June 10, 2010The ongoing search for evidence of past or ... such as proteins in Martian soil, but their absence to ... happens to these carbon-based molecules is presented in an article ... Mary Ann Liebert, Inc. The article is available free online ...
... CLEMSON, S.C. With a new twist on an ... to store "waste" energy underground to cut heating and cooling ... Molz have received a $991,000 grant from the U.S. Department ... system that can be used as a model for energy ...
... Cornell University researchers recently stretched individual molecules and ... can be used as powerful new tools for nanoscale ... 11 issue of the journal Science, probes ... important when shrinking electronics to their ultimate small size ...
Cached Biology News:New model is proposed to explain absence of organic compounds on surface of Mars 2Clemson engineers to create model underground energy-storage facility 2Clemson engineers to create model underground energy-storage facility 3Stretching molecules yields new understanding of electricity 2
(Date:3/26/2015)... LANSING, Mich., March 26, 2015 Neogen Corporation ... income for the third quarter of fiscal 2015, which ... to the prior year,s $6,575,000. Earnings per share in ... year ago. Current year-to-date net income increased 17% over ... to $20,621,000, or $0.56 per share, for the same ...
(Date:3/26/2015)... 26, 2015 Ale Gicqueau, Founder and ... of Clinical Affairs at Align Technology, on “ Conducting ... upcoming ACRP 2015 Global Conference and Exhibition on April ... , During the poster presentation, Ale Gicqueau and ... running a Postmarket Registry, the requirements and resources to ...
(Date:3/25/2015)... TORONTO , March 25, 2015 /PRNewswire/ - SQI Diagnostics ... announced that, as a result of recent discussions with ... common shares of the Company, after dealing with certain ... and special meeting of shareholders on March 26, 2015 ... that the election of directors will take place when ...
(Date:3/25/2015)... Laboratory workers can turn to ... Balances to get best-performing features while still remaining ... from the trusted brand include: , Cole-Parmer ... efficiency by providing a large weighing surface for ... include parts counting, percent weighing, checkweighing, animal/dynamic weighing, ...
Breaking Biology Technology:Neogen reports 13% increase in net income 2Neogen reports 13% increase in net income 3Neogen reports 13% increase in net income 4Neogen reports 13% increase in net income 5Neogen reports 13% increase in net income 6Neogen reports 13% increase in net income 7Neogen reports 13% increase in net income 8Clinovo Presents at ACRP 2015 in Salt Lake City, Utah on April 25th-28th 2Clinovo Presents at ACRP 2015 in Salt Lake City, Utah on April 25th-28th 3SQI Diagnostics Inc. Announces New Nominees to SQI Diagnostics Board and Adjournment of Meeting 2SQI Diagnostics Inc. Announces New Nominees to SQI Diagnostics Board and Adjournment of Meeting 3SQI Diagnostics Inc. Announces New Nominees to SQI Diagnostics Board and Adjournment of Meeting 4SQI Diagnostics Inc. Announces New Nominees to SQI Diagnostics Board and Adjournment of Meeting 5New Economical Top-Loading and Analytical Symmetry Balances from Cole-Parmer 2
... , a biopharmaceutical company developing cancer therapies, has announced ... been selected for preclinical testing and human clinical trials. ... safety assessment, it would submit to the U.S. ... application in late 2007, with human clinical trials expected ...
... Milwaukee, Wis - Understanding our genetic makeup ... to the point where DNA testing services, including ... shaping their own health management. Patients, however, will ... knowledge because most healthcare facilities are not yet ...
... The drive to make healthcare information technology interoperable ... applications, and a medical information technology company headquartered ... TeraMedica is lending its expertise to developing ... for the healthcare industry. Specifically, the expertise of ...
Cached Biology Technology:Healthcare slow to adopt genetic advances 2Healthcare slow to adopt genetic advances 3TeraMedica embraces open source project 2
... Mouse polyclonal antibody raised against a ... FES (AAH35357, 120 a.a. ~ 250 ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products: