Navigation Links
American Chemical Society’s Weekly PressPac -- May 7, 2008
Date:5/12/2008

_pageLabel=PP_SUPERARTICLE&node_id=1355&use_sec=false&sec_url_var=region1
The ACS Office of Communications is podcasting PressPac contents in order to make cutting-edge scientific discoveries from ACS journals available to a broad public audience at no charge.

PressPac information is intended for your personal use in news gathering and reporting and should not be distributed to others. Anyone using advance PressPac information for stocks or securities dealing may be guilty of insider trading under the federal Securities Exchange Act of 1934.


'/>"/>

Contact: Michael Woods
m_woods@acs.org
202-872-4400
American Chemical Society
Source:Eurekalert  

Page: 1 2 3 4 5 6 7 8

Related biology news :

1. American Chemical Societys Weekly PressPac -- April 30, 2008
2. Highlights from the May 2008 Journal of the American Dietetic Association
3. US Patent Office rejects companys claim for bean commonly grown by Latin American farmers
4. UMass Medical Schools Craig Mello elected to American Academy of Arts and Sciences
5. Nobel laureate Dr. Linda Buck elected to American Academy of Arts & Sciences 2008 Class of Fellows
6. UTSA hosts North American Energy Summit May 1-2
7. American Chemical Societys Weekly PressPac -- April 23, 2008
8. Tips from the Journals of the American Society for Microbiology
9. American College of Medical Genetics makes genetic testing recommendations in new policy statement
10. American Chemical Societys Weekly PressPac -- April 16, 2008
11. Three Dimensional Visualization of Right Ventricle Provides Important Information for Treatment of Patients with Tetralogy of Fallot, According to a Study in The American Journal of Cardiology
Post Your Comments:
*Name:
*Comment:
*Email:
Related Image:
American Chemical Society’s Weekly PressPac -- May 7, 2008
(Date:12/10/2014)... Dec. 9, 2014  Wake Forest Baptist Medical Center today ... its School of Medicine. Funding for this $50 million ... that will be publicly launched next summer. ... the former 60 series R.J. Reynolds Tobacco Company complex, ... will begin immediately with plans to be ready to ...
(Date:12/5/2014)... -- Tute Genomics, a leader in cloud-based solutions for genome ... led by UK-based Eurovestech. Peak Ventures and a number ... "We are at a pivotal time in ... seeks new approaches for the diagnosis, treatment and prevention ... and CEO of Tute Genomics. "One of the main ...
(Date:11/21/2014)... 19, 2014  Earlier this year Donald Spector ... and one of the most prolific inventors in the ... transmitted from Smartphones to third party agencies. Spector envisioned ... one of the earliest known patents in this area. ... the military, child care, elder care and hospital applications. ...
Breaking Biology News(10 mins):Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 2Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 3Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 4Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 2Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 3Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 2Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 3Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 4
... been found in male cichlid fish that evolved to lure ... the females mouths. A study in the online open access ... egg-like markings on the fins of cichlid fishes and uncovers ... the success of the fishes, exotic oral mating behaviour. ...
... TORONTO, ON Researchers are closer to understanding why ... they look, behave, think, and fight off disease, despite ... Innovative research from the University of Torontos ... new explanations for these glaring differences. In comparing brain ...
... The first State of the Carbon Cycle Report for North ... Science Program, finds the continents carbon budget increasingly overwhelmed by ... tons of carbon into the atmosphere each year, mostly as ... may remove up to half this amount, but these current ...
Cached Biology News:University of Toronto finds humans and chimps differ at level of gene splicing 2First-ever 'State of the Carbon Cycle Report' finds troubling imbalance 2
(Date:12/19/2014)... (PRWEB) December 19, 2014 The ... to the rising ageing population and technological innovations ... and nutraceutical industries are catalysing the growth of ... @ http://www.marketsandmarkets.com/Market-Reports/empty-capsules-market-218018190.html , Scope of Report ... as well as new entrants/smaller firms to gauge ...
(Date:12/19/2014)... 18, 2014 Relmada Therapeutics, Inc. (OTCQB: RLMD), ... of chronic pain, announced the results of its annual ... was a transformational year in Relmada,s history and it ... company," said Sergio Traversa , chief executive officer ... on key financial, human resource and clinical development objectives ...
(Date:12/17/2014)... RIDGE, N.J. (PRWEB) December 17, 2014 ... (Euronext: IPN; ADR: IPSEY), today ... mg (referred to as Somatuline®) was approved by ... the treatment of gastroenteropancreatic neuroendocrine tumors (GEP-NETs) in ... locally advanced or metastatic disease to improve progression-free ...
(Date:12/17/2014)... Diego, CA (PRWEB) December 17, 2014 ... and activation agency and member of the Huntsworth Health ... Gonzales to its executive team. In her role, Gonzales ... , “We are incredibly honored to welcome a ... Agency Chief and CEO, Gaëtan Fraikin. “She is a ...
Breaking Biology Technology:Empty Capsules Market Hit to Reach $1,820 Million by 2019 - New Research Report by MarketsandMarkets 2Empty Capsules Market Hit to Reach $1,820 Million by 2019 - New Research Report by MarketsandMarkets 3Empty Capsules Market Hit to Reach $1,820 Million by 2019 - New Research Report by MarketsandMarkets 4Relmada Therapeutics Announces Results of Annual Shareholders Meeting 2Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 2Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 3Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 4Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 5Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 6Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 7Ipsen Announces the FDA Approval of Somatuline® Depot® (lanreotide) Injection for the Treatment of Gastroenteropancreatic Neuroendocrine Tumors 8Audacity Welcomes Healthcare Communications Expert Jamie Gonzales as Senior Vice President of Client Services 2
... (1/25/11) -- Researchers from Boston College, MIT, Clemson and ... increase in the thermoelectric figure of merit of p-type ... in the American Chemical Society journal Nano Letters ... merit, used to measure a material,s relative thermoelectric performance, ...
... Inc. (Nasdaq: CEPH ) today announced positive ... (armodafinil) Tablets [C-IV] in patients experiencing excessive sleepiness associated ... their night shifts (i.e., 4:00 a.m. to 8:00 a.m.), ... significant difference in improvement in overall clinical condition related ...
... 2011 RxTrials, Inc., a network of premier clinical ... leading national clinical research consultant and education provider, has ... WBE certification was presented by the Women,s Business Enterprise ... site visit. The nationally recognized certification from ...
Cached Biology Technology:Nanotech milling produces dramatic increase in thermoelectric performance of bulk semiconductor 2Cephalon Announces Positive Topline Results From a Phase IV Study of NUVIGIL in Shift Work Disorder 2Cephalon Announces Positive Topline Results From a Phase IV Study of NUVIGIL in Shift Work Disorder 3Cephalon Announces Positive Topline Results From a Phase IV Study of NUVIGIL in Shift Work Disorder 4RxTrials Earns National Women-Owned Business Certification 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... kit contains sufficient materials for 1,464 array sample elements. ... 4 each , Blocker BSA in PBS (10X): ... , BupH Phosphate Buffered Saline: 8 packs ... SuperSignal West Pico Luminol Enhancer: 2 x 25 ml ...
Biology Products: