Navigation Links
Alcohol and sleep restriction can affect young men's alertness and driving performance
Date:10/1/2007

WESTCHESTER, Ill. Combining low-dose alcohol with moderate sleep restriction can have a significant adverse effect on young mens subjective alertness and performance behind the wheel, according to a study published in the October 1 issue of the journal SLEEP.

The study, authored by Andrew Vakulin, of the Adelaide Institute for Sleep Health at Repatriation General Hospital in Australia, focused on 21 healthy young men, aged 18-30 years, who all had normal sleep patterns and no sleep disorders. The participants completed a 70-minute simulated driving session, which included steering deviation, braking reaction time, and number of collisions, and underwent repeated measures with four experimental conditions: normal sleep without alcohol, sleep restriction alone (four hours) and sleep restriction in combination with two different low BACs (0.025 g/dL and 0.035 g/dL).

According to the results, steering deviation increased significantly when sleep restriction was combined with the higher dose alcohol. This combination also resulted in a greater subjective sleepiness and negative driving performance ratings compared to control or sleep restriction alone.

The ability to keep the car in the middle of the lane is critical to safe driving, and is one of the more sensitive measures of driving impairment, said Vakulin. Although steering deviation was not significantly affected by sleep restriction alone, alcohol at a BAC as low as 0.025 g/dL in combination with sleep restriction was sufficient to significantly impair steering ability. This combination may considerably reduce the threshold for safe driving, as suggested by the steering deviation data and an increase in off-road collisions following sleep restriction and alcohol ingestion in this study.

Those who think they might have a sleep disorder are urged to discuss their problem with their primary care physician, who will issue a referral to a sleep specialist.


'/>"/>

Contact: Jim Arcuri
jarcuri@aasmnet.org
708-492-0930
American Academy of Sleep Medicine
Source:Eurekalert

Page: 1

Related biology news :

1. Controversial drug shown to act on brain protein to cut alcohol use
2. Alcohols effects on gene expression in the central nervous system
3. VCU Researchers Identify Networks Of Genes Responding To Alcohol In The Brain
4. Owl genomics presents a HEPATOCHIP for diagnosis of non-alcoholic steatohepatitis
5. Alcohol consumption disrupts breastfeeding hormones
6. Investigating brain shrinkage in alcoholics
7. Russian surrogate alcohols are a killer
8. Looking for the genes that affect a persons level of response to alcohol
9. Mapping alcohol brain damage
10. Alcoholism, smoking and genetics among Plains American Indians
11. Genetic and environmental influences on alcohol consumption among rhesus monkeys
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/19/2013)... MOUNTAIN VIEW, Calif. , June 20, 2013 ... the personalized cosmeceuticals market, Frost & Sullivan recognizes ... Sullivan Award for New Product Innovation. geneOnyx leverages ... point-of-care testing to create an on-the-spot genetic test ... only a single-step DNA collection procedure from saliva ...
(Date:6/19/2013)... is playing a vital role in the survival of ... to climate and environmental changes, according to new research ... savannah birds from the Tanzanian Bird Atlas project - ... - the researchers found that they are using protected ... further west where dry seasons are getting longer, with ...
(Date:6/19/2013)... 19, 2013   Mercy Medical Center ... technology for conducting on-demand, Hemoglobin A 1c ... well as analysis of important red blood ... The new system enables the hospital to ... physicians and their patients, which can improve ...
Breaking Biology News(10 mins):Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 2Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 3Frost & Sullivan Applauds geneOnyx for its DNA Testing Solution for the Personalized Cosmeceuticals Market 4Protected areas provide African birds with stepping stones to survival 2Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 2Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 3Mercy Lab Offers Faster On-demand Diabetes Testing, Cellular Studies 4
... in biomedical science are on the horizon with ... Infrastructure (Instruct) in support of European biomedical research. ... (ESFRI) is involved in establishing about 40 such ... is one such biomedical project, whose aim is ...
... center responsible for responding goes into gear, setting off a ... from the adrenal glands. Dr. Gil Levkowitz ... now revealed a new kind of ON-OFF switch in the ... from the brain that stimulates cortisol release in the body. ...
... by a University of California, Davis, plant scientist delivers a ... world-renowned wine industry. The study is set for publication ... the Proceedings of the National Academy of Sciences. "Many ... plant, but we believe that most microbes would have difficulty ...
Cached Biology News:European Integrated Structural Biology Infrastructure launching 2A unique on-off switch for hormone production 2Fused genes tackle deadly Pierce's disease in grapevines 2
(Date:6/19/2013)... 19, 2013 Clinverse, Inc. ... for clinical trials, today announced it will be ... (booth #2000) in Boston, June 24-26, 2013. ... and only fully configurable, cloud-based clinical financial lifecycle ... module within Clinverse’s eClinical Commerce Network, automates site ...
(Date:6/19/2013)... 19, 2013 Bayer CropScience will honor ... Bee Care Community Leadership Award. The award will be ... Reception in Washington, D.C., an event where supporters of ... world’s food supply. , The Bayer Bee Care ... power of the honey bee colony to benefit their ...
(Date:6/19/2013)... India’s vast and growing population ... worth up to a billion dollars per year ... is taking serious action to better regulate and ... presentation will examine:, ,     Recent changes ... and long term impacts ,     Foreseeable opportunities ...
(Date:6/18/2013)... 2013 Tabletop SEMs are inexpensive and ... have limited performance and capability such as small sample ... would normally provide better imaging performance and more analytical ... have a higher cost of maintenance. The Pemtron ... these two types of SEM product, offering competitive prices ...
Breaking Biology Technology:Clinverse, Inc. Exhibiting and Showcasing Its Technology at DIA 2013 2Community Mentor Wins Inaugural Bayer CropScience Bee Care Leadership Award 2Community Mentor Wins Inaugural Bayer CropScience Bee Care Leadership Award 3Community Mentor Wins Inaugural Bayer CropScience Bee Care Leadership Award 4Nanounity Introduces the Pemtron Range of Compact Scanning Electron Microscopes 2Nanounity Introduces the Pemtron Range of Compact Scanning Electron Microscopes 3
... MOUNTAIN VIEW, Calif., Jan. 17, 2012  MAP Pharmaceuticals, Inc. (Nasdaq: ... James O,Shea to its Board of Directors. Mr. O,Shea brings ... product commercialization and operations. "We are privileged to ... time in the Company,s development as we focus our efforts ...
... 16, 2012 Luminex Corporation (Nasdaq: LMNX ) ... fourth quarter and full year 2011 on Monday, February 6, ... release after the close of trading. (Logo: ... conference call to discuss the operating highlights and financial results ...
... 2012 Elsevier, a world-leading provider ... services, announced today that its first bilingual platform of ... , is now available online. NursingChina ... available in China, featuring skills within specialties such ...
Cached Biology Technology:MAP Pharmaceuticals Appoints W. James O'Shea to Board of Directors 2MAP Pharmaceuticals Appoints W. James O'Shea to Board of Directors 3Luminex Corporation Fourth Quarter and Full Year 2011 Earnings Release Scheduled for February 6, 2012 2Luminex Corporation Fourth Quarter and Full Year 2011 Earnings Release Scheduled for February 6, 2012 3Elsevier Launches Bilingual International Nursing Skill Training and Management Platform: NursingChina.com 2Elsevier Launches Bilingual International Nursing Skill Training and Management Platform: NursingChina.com 3
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse polyclonal antibody raised against a partial recombinant PREB. NCBI Entrez Gene ID = 10113...
Mouse monoclonal antibody raised against a full length recombinant GPT. NCBI Entrez Gene ID = GPT...
Rabbit polyclonal antibody to GluR2...
Biology Products: