Navigation Links
Air pollution exposure affects chances of developing premenopausal breast cancer
Date:4/20/2011

BUFFALO, NY -- Exposure to air pollution early in life and when a woman gives birth to her first child may alter her DNA and may be associated with premenopausal breast cancer later in life, researchers at the University at Buffalo have shown.

The findings indicated that higher air pollution exposure at birth may alter DNA methylation, which may increase levels of E-cadherin, a protein important to the adhesion of cells, a function that plays an essential role in maintaining a stable cellular environment and assuring healthy tissues.

Methylation is a chemical process that has been implicated in determining which genes in a cell are active, a process essential to normal cellular function.

Women with breast cancer who lived in a region with more air pollution were more likely to have the alteration in the DNA in their tumor than those who lived in a less-polluted region, results showed.

Higher air pollution concentration at the time of first child birth also was associated with changes in p16, a gene involved in tumor suppression, according to findings.

Results of the research were presented April 6 at the 2011 American Association for Cancer Research annual meeting in Orlando, Fla.

Lead investigator Katharine Dobson, MPH, an epidemiology doctoral student and research assistant in UB's Department of Social and Preventive Medicine, says of the findings: "To our knowledge, this is the first study to examine exposure to ambient air pollution at key points in a woman's lifetime.

"The investigation looked for an association between exposure to pollution and alterations to DNA that influence the presence or absence of key proteins. Such genetic changes are thought to be major contributors to cancer development and progression, including at very early stages," Dobson says.

The study is based on data from the Western New York Exposures and Breast Cancer (WEB) study, which collected information from 1,1
'/>"/>

Contact: Lois Baker
ljbaker@buffalo.edu
716-645-4606
University at Buffalo
Source:Eurekalert

Page: 1 2

Related biology news :

1. Latest report on North American industrial pollution reveals impacts on our shared water environment
2. Cephalopods experience massive acoustic trauma from noise pollution in the oceans
3. Study: Emissions trading doesnt cause pollution hot spots
4. The dark side of spring? Pollution in our melting snow
5. Pinpointing air pollutions effects on the heart
6. Hold your breath: Air pollution plays role in cardiac, metabolic diseases
7. Protecting ecosystems, pollution remediation goals of research at UH
8. Pollution with antibiotics leads to resistant bacteria
9. Pollution tax rebates little help for low-income workers
10. University of Miami scientists find new way to estimate global rainfall and track ocean pollution
11. Morning-after spike in ozone air pollution from Super Bowl XLV?
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:6/25/2015)... June 25, 2015 According ... Type (Swipe & Area), Technology, Material (Optical Prism, ... Commercial Security & Others) & Geography - Global ... the said market is expected to reach $14,500.07 ... Browse 76 market Tables and ...
(Date:6/25/2015)... , June 25, 2015  TAKE Solutions Ltd., ... patent by the United States Patent and Trademark Office ... This process leverages TAKE Solutions, Clinical Accelerators to reduce ... 50% (when compared to standardization without the accelerators), thus ... At the heart of the ...
(Date:6/24/2015)... NEW YORK , June 24, 2015 ... Systems market, over the next six years. It contains ... affect the industry, along with their impact from the ... It also discusses the industry, market, and technology ... expected that the need of concerned authorities to efficiently ...
Breaking Biology News(10 mins):Fingerprint Sensors Market Worth $14,500.07 Million by 2020 2Fingerprint Sensors Market Worth $14,500.07 Million by 2020 3Fingerprint Sensors Market Worth $14,500.07 Million by 2020 4TAKE Solutions Awarded Patent By USPTO 2Automatic Identification System Market by Class, by Platform, by Application and by Geography - Global Forecasts & Analysis to 2014 - 2020 2
... ?one from Louisiana, one from Japan and one ... to involvement of endocannabinoids as a novel neural ... in eating, disease treatment and social behavior. , ... team from Tulane and Louisiana State Universities, led ...
... as fertility drugs may be ineffective for women who ... study showed that fertility drugs did not improve ovulation ... estrogen receptor beta. The estrogen receptor beta is one ... of estrogen hormones and are present throughout the female ...
... extension in yeast have been identified by researchers from UC ... or caloric restriction, is known to extend the lifespan of ... gene called Sir2 with lifespan extension due to caloric restriction, ... when put on a tough diet, showing that some other ...
Cached Biology News:Endocannabinoids ?the brain's cannabis ?demonstrate novel modes of action to stress 2New Discovery May Help Doctors Treat Infertility 2New Discovery May Help Doctors Treat Infertility 3
(Date:7/2/2015)... 2, 2015  Spherix Incorporated (Nasdaq: SPEX ) -- an ... monetization of intellectual property, today announced a litigation update. ... v. Verizon Services Corp. et al. , Case No. ... Eastern District of Virginia , the ... interpreting certain key claims in favor of the Defendants ...
(Date:7/1/2015)... ... July 01, 2015 , ... It is now possible ... using single photon emission computed tomography (SPECT) according to researchers from Amen ... examined over 20,000 brain scans and is believed to be the largest brain imaging ...
(Date:7/1/2015)... AURORA, Colo. and BANGALORE, India ... a global genomic profiling company that uses next generation ... appointment of Scott A. Storrer as chief ... and CEO, he will be responsible for all strategy, ... Vijay Chandru , who has served as Strand,s chairman ...
(Date:7/1/2015)... ... July 01, 2015 , ... A newly launched business plan contest ... the barriers to innovation in life sciences R&D. The Pistoia Alliance President’s Startup Challenge ... of US$15,000 and a period of expert mentorship from a senior industry figure drawn ...
Breaking Biology Technology:Spherix Issues A Litigation Update 2Spherix Issues A Litigation Update 3Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 2Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 3Brain Scans Can Tell Post-Traumatic Stress Disorder and Traumatic Brain Injury Apart According to New Research by Amen Clinics 4Strand Life Sciences Names Scott A. Storrer CEO as Company Continues Global Expansion with Focus on Precision Medicine Product 2Strand Life Sciences Names Scott A. Storrer CEO as Company Continues Global Expansion with Focus on Precision Medicine Product 3Pistoia Alliance Launches Startup Challenge 2Pistoia Alliance Launches Startup Challenge 3
... Calif.,  Oct. 27 SRI International, an independent nonprofit ... Geysen, Ph.D., has joined SRI International,s Center for Advanced ... new role, Dr. Geysen will expand SRI,s research capabilities ... establish programs to develop novel molecules that control hormonal ...
... PDL BioPharma, Inc. (PDL, the Company) ... entered into separate privately negotiated exchange agreements under which it ... outstanding 2.00% Convertible Senior Notes due February 15, 2012 (the ... the 2012 Notes will receive $92.0 million in aggregate principal ...
... 27 Ardea Biosciences, Inc. (Nasdaq: RDEA ) ... executive officer, will present at the Oppenheimer 21st Annual Healthcare ... present at 10:50 a.m. EDT on Tuesday, November 2, 2010. ... be accessed on the Investor Relations section of Ardea,s website ...
Cached Biology Technology:Distinguished Scientist H. Mario Geysen Joins SRI International to Lead Combinatorial Sciences and Metabolic Diseases Research Programs 2Distinguished Scientist H. Mario Geysen Joins SRI International to Lead Combinatorial Sciences and Metabolic Diseases Research Programs 3PDL BioPharma Announces Exchange to Retire 2.00% Convertible Senior Notes Due February 15, 2012 2PDL BioPharma Announces Exchange to Retire 2.00% Convertible Senior Notes Due February 15, 2012 3Ardea Biosciences to Present at the Oppenheimer 21st Annual Healthcare Conference 2
Mouse monoclonal antibody raised against a partial recombinant PASK. NCBI Entrez Gene ID = PASK...
Mouse monoclonal antibody raised against a partial recombinant CRKRS. NCBI Entrez Gene ID = CRKRS...
... against a partial recombinant FES. ... ~ 250 a.a) partial recombinant protein with ... WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... AAH35357 OMIM: ...
... antibody raised against a partial ... Immunogen: PPP4C (NP_002711, 218 ... recombinant protein with GST tag. ... NM_002720 ...
Biology Products: