Navigation Links
Agriculture & food production contribute up to 29 percent of global greenhouse gas emissions
Date:10/30/2012

ird of the greenhouse gases emitted by people on this planet. This figure accounts for every aspect of food production and distributionincluding growing crops and raising livestock, manufacturing fertilizer, and storing, transporting and refrigerating food. Agriculture accounts for around 80 percent of these emissions, but the combined contribution of transport, refrigeration, consumer practices and waste management is growing.

"The food-related emissions and, conversely, the impacts of climate change on agriculture and the food system, will profoundly alter the way we grow and produce food. This will affect different parts of the world in radically different ways, but all regions will have to change their current approach to what they grow and eat," said Sonja Vermeulen, the head of research at CCAFS and the lead author of Climate Change and Food Security.

Determining what crops grow in which places

Yields of the three biggest crops in terms of calories providedmaize, rice and wheatwill decrease in many developing countries as temperatures rise and rainfall becomes more unpredictable, according to Recalibrating Food Production in the Developing World. The analysis, which studies the potential effects of climate change on 22 of the world's most important commodities, highlights the impending transformations of the agricultural landscape.

By 2050, climate change could cause irrigated wheat yields in developing countries to fall by 13 percent. Irrigated rice is these same countries could tumble 15 percent. In Africa, many farmers of maize, which is not that well suited to increased temperatures, could lose 10 to 20 percent of their yields.

Additional calorie and protein sources will also suffer in many places. The cost of feeding livestock with maize and grain will become more expensive. And the availability of fishwhich are particularly susceptible to higher temperatures and higher ocean salinitywi
'/>"/>

Contact: Dan Klotz
dklotz@burnesscommunications.com
301-280-5756

Michelle Geis
mgeis@burnesscommunications.com
301 2805712

Burness Communications
Source:Eurekalert


Page: 1 2 3 4

Related biology news :

1. Rice agriculture accelerates global warming, new research finds
2. Study shows hope of greater global food output, less environmental impact of agriculture
3. Clemson scholar receives top agriculture science award
4. U of M researchers Darwinian Agriculture explains how evolution can improve agriculture
5. Is rainfall a greater threat to Chinas agriculture than warming?
6. EyeLock Inc. Brings High-Tech Iris Biometric Production to Texas
7. Brainy beverage: Study reveals how green tea boosts brain cell production to aid memory
8. Clemson plant pathologist working to raise cucurbit yields, lower production costs
9. New process doubles production of alternative fuel while slashing costs
10. Cost-effective production of infrared lenses
11. Childhood obesity may affect timing of puberty, create problems with reproduction
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:9/23/2014)... the development of animals and plants. The central problem ... translated in a reliable manner to give specific spatial ... of stripe formation is a classic paradigm in developmental ... the French flag, is caused by a gradient of ... low concentrations of the morphogen a "blue", "white" or ...
(Date:9/23/2014)... SPRINGS, Florida , September 23, 2014 ... for innovative companies in tech sector position for significant investor ... products & services.  Companies in focus today are: NXT-ID, Inc. ... BABA ), Mobileye N.V. (NYSE: MBLY ... Robotics Ltd. (NASDAQ: RWLK) NXT-ID, Inc. (NASDAQ: ...
(Date:9/22/2014)... Many native species have vanished from tropical islands ... scientists have discovered how fossils can be used ... lies in organic materials found in fossil bones, ... according to a new study available online and ... of Herpetology . Pre-human island ecosystems provide vital ...
Breaking Biology News(10 mins):Recreating the stripe patterns found in animals by engineering synthetic gene networks 2Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 2Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 3Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 4Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 5Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 6Latest Blockbuster IPOs and Up Listings for Global Tech Stocks Attracting Major Attention as Traders Focus on Key Economic Data Due this Week 7Answer to restoring lost island biodiversity found in fossils 2
... , HERNDON, Va., Dec. 15 The PTR ... announced that it has agreed to sponsor three high school teams ... http://usfirst.org ). , The PTR Group will provide funding ... teams from Atholton HS in Columbia, MD, Rockwall HS in Rockwall, ...
... often promoted as a clean-burning, renewable fuel that could help ... caused by ozone, compared with gasoline, especially in winter, according ... Ozone production from both gasoline and E85, a blend of ... in warm sunny weather than during the cold weather and ...
... 10, 2009If you are spending the holidays with big Uncle ... be better off with another family, spare a thought for ... McMaster University and the University of New South Wales has ... members make strategic decisions about their living situation. ...
Cached Biology News:The PTR Group Announces Financial and Technical Support to US FIRST Robotics Competition Teams 2Ethanol-powered vehicles generate more ozone than gas-powered ones 2Ethanol-powered vehicles generate more ozone than gas-powered ones 3
(Date:9/23/2014)... 23, 2014 Texas Fertility Center (TFC) ... South Austin, expanding a Central Texas footprint that includes ... The satellite office for the region’s most established practice ... the South Austin, Buda, Kyle and San Marcos communities. ... fertility treatment directly to individuals and couples living in ...
(Date:9/23/2014)... (PRWEB) September 23, 2014 The ... a developer of cellular modems , platforms ... in the Startup category for the 2014 Tekne ... held at the Minneapolis Convention Center on Thursday, ... and individuals who have shown superior technology innovation ...
(Date:9/22/2014)... YORK and SANTA CLARA, Calif. ... Corp. (NASDAQ: WBMD ), the leading source ... new WebMD/Medscape survey that provide novel insights ... in aiding diagnosis and care.  Dr. Eric Topol ... and digital medicine, who serves as both Editor-in-Chief of ...
(Date:9/22/2014)... in a mouse model of pancreatic cancer identified distinct ... including significant differences from the primary tumor that may ... their study reported in the Sept. 25 issue of ... Hospital (MGH) Cancer Center identified several different classes of ... to be targets for improved treatment of the deadly ...
Breaking Biology Technology:Opening Doors to a Family: Texas Fertility Center Announces Newest Fertility Clinic in South Austin 2Opening Doors to a Family: Texas Fertility Center Announces Newest Fertility Clinic in South Austin 3NimbeLink Named Finalist for 15th Annual Tekne Awards 2NimbeLink Named Finalist for 15th Annual Tekne Awards 3WebMD/Medscape Digital Technology Survey Reveals Unique Insights Into How Patients and Physicians Perceive the Role, Potential and Risks Associated with Digital Health Technologies 2WebMD/Medscape Digital Technology Survey Reveals Unique Insights Into How Patients and Physicians Perceive the Role, Potential and Risks Associated with Digital Health Technologies 3WebMD/Medscape Digital Technology Survey Reveals Unique Insights Into How Patients and Physicians Perceive the Role, Potential and Risks Associated with Digital Health Technologies 4Massachusetts General study reveals gene expression patterns in pancreatic CTCs 2Massachusetts General study reveals gene expression patterns in pancreatic CTCs 3
... (NASDAQ: NEOG ) announces the following Webcast:What: ... 26, 2011 @ 11:00 ETWhere: , http://www.videonewswire.com/event.asp?id=80894 How: ... on to the web at the address above.  Contact: ... are unable to participate during the live webcast, the ...
... ,   Elsevier, a ... services, today announced the,highlights of its journal Impact Factor ... ® ,published by Thomson Reuters, Elsevier saw over 55% ... while slightly over 49%,of non-Elsevier journals showed an increased ...
... ,   Executives from O2h ... agreement to substantially,increase the number of FTE chemists provided by ... Congreve, Head of Chemistry at Heptares said, "O2h has,been a ... our synthetic chemistry team to include a full lab unit ...
Cached Biology Technology:Elsevier Announces 2010 Journal Impact Factor Highlights 2Elsevier Announces 2010 Journal Impact Factor Highlights 3Oxygen Healthcare (O2h) Announces Expanded Chemistry Collaboration With Heptares Therapeutics 2
Mouse monoclonal antibody raised against a partial recombinant DENR. NCBI Entrez Gene ID = DENR...
Mouse monoclonal antibody raised against a partial recombinant IL31RA. NCBI Entrez Gene ID = IL31RA...
... monoclonal antibody raised against a partial recombinant NFKBIB. ... a.a. ~ 145 a.a) partial recombinant protein with ... EDGDTALHLAVIHQHEPFLDFLLGFSAGTEYMDLQNDLGQTALHLAAILGETSTVEKLYAAGAGLCVAERRGHTALHLACRVGAHACARA Accession: BC015528 ... OMIM: 604495, ...
... Mouse polyclonal antibody raised against a partial ... FES (AAH35357, 120 a.a. ~ 250 a.a) ... Protein Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA ... Protein Accession Number: AAH35357 ...
Biology Products: