Navigation Links
AVS 55th International Symposium & Exhibition, Oct. 19-24
Date:10/1/2008

ng and Virtual Periscope: See: http://www.avssymposium.org/Session.asp?sessionID=142.

FRONTIERS OF PHYSICS

The Industrial Physics Forum (IPF) also hosts the Frontiers in Physics Symposium, showcasing some of the top speakers on some of the hottest topics in physics. This year's symposium speakers are as follows: J. Gordon (IBM Almaden Research Center) on developing nano-circuits; J. Flanz (Massachusetts General Hospital) on proton cancer therapy; J. Ye (National Institute of Standards and Technology) on the best atomic clocks; and M. Lukin (Harvard University) on diamond circuitry. The session will be from 1:40 to 4:40 p.m. on Tuesday, October 21, 2008 in Room 312 of the Hynes Convention Center. See: http://www.avssymposium.org/Session.asp?sessionID=143.

SHORT COURSES

AVS promotes communication, dissemination of knowledge, recommended practices, research, and education in a broad range of technologically relevant topics. One way that it does this is by offering short courses in areas such as

  • Vacuum processing design, operation, and maintenance;
  • Characterization of films, surfaces, particles, and interfaces; and
  • Materials processing, modification.

In Boston, AVS will offer short courses on everything from engineering solar cells to the latest technologies for analyzing biological molecules. To access the complete short course schedule, see: http://www.avs.org/education.schedule.aspx#national_schedule.


'/>"/>

Contact: Jason Bardi
jbardi@aip.org
301-209-3091
American Institute of Physics
Source:Eurekalert

Page: 1 2 3 4 5 6 7

Related biology news :

1. BIO-key(R) International to Showcase Deployed Biometric Security Applications at 2007 Biometric Technology Expo
2. ESMO International Symposium on Immunology
3. Conservation International and Toyota partner to protect Philippines rain forests
4. International team shows mercury concentrations in fish respond quickly to increased deposition
5. International team shows mercury concentrations in fish respond quickly to increased deposition
6. BIO-key(R) International to Showcase Deployed Biometric Security Applications at 2007 Biometric Technology Expo
7. Youngstown, Ohio Police Award Mobile Data Contract to BIO-key(R) International
8. Clemson physicist addresses international forum on thermoelectric energy
9. US launch of international consultation for new responsible nanocode
10. International team of scientists warns of climate changes impact on global river flow
11. BIO-key International Showcasing Innovative Public Safety Solutions at 2007 IACP Conference
Post Your Comments:
*Name:
*Comment:
*Email:
(Date:12/10/2014)... Dec. 9, 2014  Wake Forest Baptist Medical Center today ... its School of Medicine. Funding for this $50 million ... that will be publicly launched next summer. ... the former 60 series R.J. Reynolds Tobacco Company complex, ... will begin immediately with plans to be ready to ...
(Date:12/5/2014)... -- Tute Genomics, a leader in cloud-based solutions for genome ... led by UK-based Eurovestech. Peak Ventures and a number ... "We are at a pivotal time in ... seeks new approaches for the diagnosis, treatment and prevention ... and CEO of Tute Genomics. "One of the main ...
(Date:11/21/2014)... 19, 2014  Earlier this year Donald Spector ... and one of the most prolific inventors in the ... transmitted from Smartphones to third party agencies. Spector envisioned ... one of the earliest known patents in this area. ... the military, child care, elder care and hospital applications. ...
Breaking Biology News(10 mins):Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 2Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 3Wake Forest Baptist to Build New Medical Education Facility In Wake Forest Innovation Quarter 4Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 2Tute Genomics Raises $2.3 Million to Scale Up Cloud-Based Genome Analytics and Accelerate Personalized Medicine 3Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 2Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 3Patented Biosensor Wearable Technology Provides a More Civilized Method of Quarantine 4
... You don,t need to spray weedkiller to remove the ... with either boiling water, steam or flaming will dispatch even ... a new PhD project from the University of Copenhagen. ... is important that each treatment is dosed correctly. Basically, ...
... Johns Hopkins scientists have engineered cells that behave like ... on one or more unique inputs. This feat, published in ... eventually help researchers create computers that use cells as tiny ... in the Department of Cell Biology and member of the ...
... BETHESDA, MD May 30, 2012 The Genetics Society ... six graduate students and seven postdoctoral researchers as recipients of ... Each of these early-career geneticists receives a $1,000 travel award ... in a laboratory course of their choice that will enhance ...
Cached Biology News:Blanch your weeds 2Training cells to perform Boolean functions? It's logical 2Training cells to perform Boolean functions? It's logical 3The Genetics Society of America announces DeLill Nasser Travel Award recipients 2
(Date:12/19/2014)... N.Y. , Dec. 18, 2014 Egenix, Inc. ... has been elected Chairman of the Board, to succeed ... and CEO, but will continue as a member of the ... he has added to the company over almost twenty years, ... The Board of Directors has established a Search Committee ...
(Date:12/17/2014)... USA (PRWEB) December 16, 2014 ... manager at Philipps- Universität Marburg’s Department of Physics, ... photonics, in the newly released SPIE Women ... never be too shy to ask questions.” , ... technology, engineering, and mathematics) occupations ranging from university ...
(Date:12/17/2014)... Xeno Diagnostics has again received ... recent COLA inspection. Xeno has met all criteria ... accreditation organization. Accreditation is earned only by laboratories ... operations, demonstrate continued accuracy in the performance of ... survey. , While the Laboratory Excellence ...
(Date:12/17/2014)... Md. , Dec. 17, 2014 CASI ... company dedicated to the acquisition, development and commercialization of ... for the global market with a primary commercial focus ... it has been granted a Type C meeting with ... the meeting will be held in February 2015.  During ...
Breaking Biology Technology:Network, Multitask, Persevere: SPIE Women in Optics Planner Subjects Share from Experience 2Network, Multitask, Persevere: SPIE Women in Optics Planner Subjects Share from Experience 3Xeno Diagnostics Receives 3rd Award for Laboratory Excellence 2CASI Pharmaceuticals Granted Type C Meeting With U.S. FDA For ENMD-2076 In Fibrolamellar Carcinoma 2CASI Pharmaceuticals Granted Type C Meeting With U.S. FDA For ENMD-2076 In Fibrolamellar Carcinoma 3CASI Pharmaceuticals Granted Type C Meeting With U.S. FDA For ENMD-2076 In Fibrolamellar Carcinoma 4CASI Pharmaceuticals Granted Type C Meeting With U.S. FDA For ENMD-2076 In Fibrolamellar Carcinoma 5
... BioMed Realty Trust, Inc. (NYSE: BMR ), a real ... Science Industry®, today announced financial results for the third quarter ended ... Generated record total revenues for the third quarter of ... in 2009. Increased rental revenues for the third quarter by ...
... to develop relatively advanced tools after their brains evolved a ... that investigates why it took early humans almost two million ... axe. Researchers used computer modelling and tiny sensors embedded ... humans needed in order to make two types of tools ...
... New Mexico, NOVEMBER 3, 2010Scientists at the U.S. Department ... Laboratory have fabricated transparent thin films capable of absorbing ... area. The material, described in the journal Chemistry ... transparent solar panels. "Potentially, with future refinement of ...
Cached Biology Technology:BioMed Realty Trust Reports Third Quarter 2010 Financial Results 2BioMed Realty Trust Reports Third Quarter 2010 Financial Results 3BioMed Realty Trust Reports Third Quarter 2010 Financial Results 4BioMed Realty Trust Reports Third Quarter 2010 Financial Results 5BioMed Realty Trust Reports Third Quarter 2010 Financial Results 6BioMed Realty Trust Reports Third Quarter 2010 Financial Results 7BioMed Realty Trust Reports Third Quarter 2010 Financial Results 8BioMed Realty Trust Reports Third Quarter 2010 Financial Results 9BioMed Realty Trust Reports Third Quarter 2010 Financial Results 10BioMed Realty Trust Reports Third Quarter 2010 Financial Results 11BioMed Realty Trust Reports Third Quarter 2010 Financial Results 12BioMed Realty Trust Reports Third Quarter 2010 Financial Results 13BioMed Realty Trust Reports Third Quarter 2010 Financial Results 14BioMed Realty Trust Reports Third Quarter 2010 Financial Results 15BioMed Realty Trust Reports Third Quarter 2010 Financial Results 16BioMed Realty Trust Reports Third Quarter 2010 Financial Results 17Stone Age humans needed more brain power to make big leap in tool design 2Scientists produce transparent, light-harvesting material 2
... raised against a partial recombinant FES. ... a.a. ~ 250 a.a) partial recombinant protein ... Sequence: WQQLQQELTKTHSQDIEKLKSQYRALARDSAQAKRKYQEASKDKDRDKAKDKYVRSLWKLFAHHNRYVLGVRAAQLHHQHHHQLLLPGLLRSLQDLHEEMACILKEILQEYLEISSLVQDEVVAIHREMAA Accession: ... Number: AAH35357 OMIM: ...
Mouse monoclonal antibody raised against a partial recombinant ACTN4. NCBI Entrez Gene ID = ACTN4...
Mouse monoclonal antibody raised against a partial recombinant PDE2A. NCBI Entrez Gene ID = PDE2A...
... kit contains sufficient materials for 1,464 array sample elements. ... 4 each , Blocker BSA in PBS (10X): ... , BupH Phosphate Buffered Saline: 8 packs ... SuperSignal West Pico Luminol Enhancer: 2 x 25 ml ...
Biology Products: